SecReT4
Protein ID: 222110518
T4SS name [ID]Trb [356]
Gene symbol-
Locus tagDtpsy_1317
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1377639..1378025 [+]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDB9MH77
KEGG IDdia:Dtpsy_1317
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.6e-24, Aligned region: 34..118
Protein Sequence: 128 a.a.     [Download]
>gi|222110518|ref|YP_002552782.1| conjugal transfer protein Trbc [Acidovorax ebreus TPSY]
MTHVDAFRISVSPLFHLSRFTRLRSLAPPAGQGLLLAALLLFLAGTAQAAGSSMPWEGPLQSILESIQGP
VARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 387 bp     [Download]
>gi|222109225|ref|NC_011992.1|:1377639-1378025 Acidovorax ebreus TPSY chromosome, complete genome
ATGACGCATGTTGATGCTTTCCGTATTTCCGTAAGTCCGCTTTTCCACCTGTCCCGATTCACGCGGCTAC
GCAGCCTGGCTCCCCCTGCGGGGCAAGGGCTGCTGCTGGCCGCGCTGCTGCTGTTCCTGGCCGGCACCGC
CCAGGCCGCCGGTTCCTCGATGCCGTGGGAAGGCCCGCTGCAATCCATCCTCGAATCCATCCAGGGACCG
GTGGCGCGCATCGTCGCGGTCATCATCATCATCGCCACGGGCTTGGCGCTGGCCTTTGGAGATACGTCGG
GCGGCTTCCGCAAGCTGATCCAGATCGTCTTTGGCTTGTCCATCGCTTTCGCGGCTTCAAGCTTCTTCCT
GTCGTTCTTCAGCTTCTCGGGCGGGGCCGTCGTATGA
 Primer design