SecReT4
Protein ID: 222110523
T4SS name [ID]Trb [356]
Gene symbol-
Locus tagDtpsy_1322
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1381843..1383222 [+]
Productconjugal transfer protein Trbl
Component typeTrbL
UniProt IDB9MH82
KEGG IDdia:Dtpsy_1322
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.5e-48, Aligned region: 37..264
Protein Sequence: 459 a.a.     [Download]
>gi|222110523|ref|YP_002552787.1| conjugal transfer protein Trbl [Acidovorax ebreus TPSY]
MNDVTIIDQFLATFAAYIDSGFGLLRGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDVIAKLLRKVLY
VGAFAYIINNFNWLASIVFRSFAGLGITATGSAITMENFLQPGRLAKTGIDAGAPILEQIGEMAGFPEVF
VNLDPIVVMFLAWLVVVLCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTAFLAEKVLGNVVASGVK
VLVLAVIVGIGSGLFAQFQVHPAEPSIDHALVIMLASLTLLALGIFGPGIATGLVSGAPQLGAGAMAGAA
VGAAGTAVVIGAAATGVGGAVAAGARMAPAAAKLAGSGARAATSAASSAKSTFQAGSAAAGGAAKGAMAG
LGNVAKTGAQSAGRAAASRASAAGQRMAAPFRAGWNGTTADAGASTGQASAGEAPAGGAAAQKPEQPAWA
KRLHRRQQLTHAATTAAHTLRGGDGGGSGQGPSLRGSDD
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|222109225|ref|NC_011992.1|:1381843-1383222 Acidovorax ebreus TPSY chromosome, complete genome
ATGAATGACGTGACCATCATCGACCAATTCCTCGCCACATTCGCCGCCTACATCGACTCGGGTTTCGGAC
TGCTGCGGGGCGAAGTGGCGTTCCTCACAGCCACGTTGATCGTCATCGACATGACGATCGCCGGCCTGTA
TTGGGCCATGAGCCACGCTACCGGCCAAGGCGAGGACGTGATCGCCAAGCTGCTGCGCAAGGTGCTCTAC
GTCGGTGCCTTCGCCTACATCATCAACAACTTCAACTGGCTGGCCAGCATCGTGTTCCGCTCGTTTGCGG
GATTGGGCATCACCGCCACCGGCTCGGCCATCACGATGGAGAACTTCTTGCAGCCGGGCCGGCTGGCGAA
AACCGGCATCGACGCCGGGGCGCCGATTCTGGAGCAGATCGGCGAGATGGCAGGCTTTCCCGAAGTGTTC
GTGAACCTCGACCCCATCGTGGTGATGTTCCTCGCCTGGCTGGTCGTGGTGCTGTGCTTCTTCGTGCTGG
CAATCCAGCTTTTCATCACGCTGATCGAGTTCAAGCTGACCACGCTCGCCGGATTCGTGCTGGTGCCGTT
CGCGCTCTGGAACAAGACCGCGTTCCTCGCCGAAAAGGTCTTGGGCAACGTGGTGGCCTCCGGCGTCAAG
GTTCTGGTACTGGCCGTGATCGTCGGTATCGGCTCGGGCTTGTTCGCTCAGTTCCAAGTCCATCCTGCCG
AGCCGTCTATCGACCACGCGCTGGTCATCATGCTGGCCTCGCTCACCTTGCTGGCGCTCGGGATCTTTGG
CCCCGGCATCGCCACCGGCCTTGTGTCCGGTGCGCCGCAGCTCGGCGCGGGCGCGATGGCTGGTGCTGCT
GTCGGCGCTGCCGGCACGGCCGTTGTCATCGGTGCCGCCGCGACGGGCGTGGGTGGCGCCGTGGCTGCTG
GCGCGCGCATGGCCCCGGCTGCCGCAAAGCTGGCCGGTAGCGGTGCGCGCGCCGCAACGTCGGCGGCCAG
CAGTGCGAAGTCGACGTTTCAGGCCGGTTCCGCCGCCGCTGGCGGCGCCGCAAAGGGCGCGATGGCGGGC
CTGGGCAACGTCGCCAAGACCGGCGCGCAGTCCGCCGGACGCGCCGCAGCGTCCCGTGCTTCCGCTGCCG
GGCAGCGGATGGCCGCTCCGTTCCGTGCTGGCTGGAATGGCACGACGGCCGACGCTGGCGCGTCAACCGG
CCAAGCCTCCGCAGGAGAAGCCCCCGCAGGCGGCGCCGCTGCACAGAAGCCGGAACAACCCGCCTGGGCC
AAGCGGCTGCATCGCCGCCAGCAACTCACCCACGCCGCGACCACCGCCGCGCACACGCTGCGCGGTGGCG
ACGGTGGCGGCTCGGGGCAAGGCCCGAGCCTGCGCGGCTCCGACGACTAA
 Primer design