SecReT4
Protein ID: 222110525
T4SS name [ID]Trb [356]
Gene symbol-
Locus tagDtpsy_1324
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1383948..1384937 [+]
Productp-type conjugative transfer protein trbg
Component typeTrbG
UniProt IDB9MH84
KEGG IDdia:Dtpsy_1324
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6.8e-67, Aligned region: 103..322
Protein Sequence: 329 a.a.     [Download]
>gi|222110525|ref|YP_002552789.1| p-type conjugative transfer protein trbg [Acidovorax ebreus TPSY]
MNLSFRFYAFVLTLAALSGCASQGKPPPRISLDEPVLAQPLPEPPKPVEVVEVPKVLPMPAQMKPLPDVD
EDKPTPEPVDETVRVSRANAEARIAPTREGYVNAIQVWPFTDGALYQVYAAPGRVTVVSLQPGEELVTVA
AGDTVRWIVGDTSSGAGAELRFNVLVKPTRSGLKTNLVVTTNRRTYLLELTSTEKAWMASVSWDYPKDRM
LALQRQSQTAQATAPVDTGLSLEKIRFRYAVSGSNPPWKPLRAFDDGEKVYIQFPGGIAQGELPPLFVIG
AQGDGQLVNYRFRSPYYIVDRLFGAAELRLGGDKGDVVRIERTDGTRGK
 
Nucleotide Sequence: 990 bp     [Download]
>gi|222109225|ref|NC_011992.1|:1383948-1384937 Acidovorax ebreus TPSY chromosome, complete genome
ATGAACCTGTCTTTCCGCTTTTACGCTTTTGTGCTGACCTTGGCGGCCCTGTCGGGCTGCGCCTCGCAGG
GCAAGCCACCGCCACGCATCTCGCTCGATGAGCCGGTGCTGGCGCAGCCGTTGCCCGAACCACCGAAGCC
GGTGGAAGTGGTGGAGGTGCCGAAGGTGCTGCCGATGCCGGCGCAGATGAAGCCGCTGCCTGACGTGGAC
GAAGACAAGCCCACGCCAGAGCCTGTCGACGAAACCGTGCGCGTCTCGCGTGCCAACGCCGAGGCGCGCA
TCGCGCCGACTCGCGAGGGCTATGTCAACGCGATTCAGGTGTGGCCTTTCACTGATGGCGCGCTGTATCA
GGTCTACGCCGCGCCGGGGCGCGTCACCGTCGTGTCCCTACAGCCGGGCGAGGAACTGGTGACGGTCGCC
GCCGGCGACACGGTGCGCTGGATTGTTGGCGATACGTCCAGCGGCGCCGGCGCCGAGCTGCGCTTCAACG
TGCTGGTGAAGCCCACCCGGTCGGGCCTCAAGACCAATCTAGTCGTCACCACGAACCGCAGGACATACCT
GCTGGAACTGACCTCGACGGAAAAAGCGTGGATGGCATCGGTGTCTTGGGACTATCCGAAAGACCGGATG
TTGGCCTTGCAGCGCCAGTCGCAGACCGCGCAGGCGACCGCGCCGGTCGATACGGGCTTGTCGCTGGAGA
AGATTCGCTTCCGCTATGCGGTCAGCGGCAGCAATCCACCGTGGAAGCCATTGCGCGCTTTCGACGACGG
CGAGAAGGTCTATATCCAGTTCCCGGGAGGCATCGCGCAGGGCGAGTTGCCTCCCTTGTTCGTGATCGGC
GCGCAGGGCGACGGGCAACTGGTGAACTACCGCTTCCGCTCACCGTACTACATCGTGGATCGGCTGTTCG
GCGCGGCCGAACTTCGCCTGGGCGGGGACAAGGGCGACGTGGTGCGCATCGAGCGCACGGATGGCACGCG
GGGGAAATGA
 Primer design