SecReT4
Protein ID: 222112658
T4SS name [ID]Trb [357]
Gene symbol-
Locus tagDtpsy_3497
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]3747460..3748731 [-]
Productconjugation trbi family protein
Component typeTrbI
UniProt IDB9MII4
KEGG IDdia:Dtpsy_3497
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6.4e-56, Aligned region: 227..409
Protein Sequence: 423 a.a.     [Download]
>gi|222112658|ref|YP_002554922.1| conjugation trbi family protein [Acidovorax ebreus TPSY]
MSQDDTPDLAAPQAGKVAPEAVALRAQPRPVTRLNRRTLAILVGGLSVAVLGATIWSLQPHRRGAGEQTE
LYNVDRVSKSEGLDGLPADYSKLPPKVPELGPALPGDLGPAIVHSQQPVTPAYAPPGHDPADARRKEADA
AAGSSVFFRSGNQGKATAPVTAQAAAAAPGSALAGFDPLAAGPASTAAQSSDPTAVQNRQDQKEAFLKGG
STETRNSGNLQMPSSPYQVMAGTVMAGALVTGIKSDLPGDVIATVTEPVYDSATGKFLLIPQGSRILGKY
NSQVSYGQSRVQVVWNRVILPDTSSLKLDNLAGTDPAGYAGLEDGVDWHWDRVFAGAALTTLLGVGAELA
APENRQNGNRIVIAGRDSAQDSINQVGQEMTRRNMNIQSTLTERPGLPVRIIVNRDLVLRPYQPMFFQRG
AMQ
 
Nucleotide Sequence: 1272 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c3748731-3747460 Acidovorax ebreus TPSY chromosome, complete genome
ATGAGCCAGGACGACACTCCAGACCTTGCCGCGCCACAGGCGGGCAAGGTCGCGCCCGAAGCGGTGGCGC
TGCGCGCCCAGCCGCGCCCGGTCACACGTTTGAACCGGCGCACGCTGGCCATTCTCGTCGGCGGCCTGTC
GGTCGCAGTGCTCGGGGCCACGATTTGGTCGTTGCAGCCGCATCGGCGCGGGGCGGGCGAGCAGACCGAG
CTTTACAACGTCGATCGCGTCTCGAAGTCGGAAGGGCTGGACGGACTGCCTGCCGACTACTCGAAGCTGC
CGCCGAAGGTGCCTGAGCTGGGGCCGGCGCTGCCGGGCGACCTCGGCCCGGCCATCGTGCATTCTCAACA
GCCGGTGACGCCAGCCTACGCACCGCCGGGACATGATCCGGCGGACGCCCGGCGCAAGGAGGCCGATGCA
GCGGCGGGTTCGTCGGTGTTCTTCCGTTCGGGCAACCAAGGCAAGGCCACCGCGCCGGTCACGGCGCAAG
CCGCTGCGGCTGCGCCCGGTAGTGCCTTGGCGGGCTTCGACCCGCTGGCCGCTGGCCCGGCCTCTACGGC
GGCCCAGTCATCCGACCCGACCGCCGTGCAGAACCGGCAAGACCAGAAAGAGGCTTTCCTGAAAGGCGGC
TCTACGGAAACCCGCAATTCCGGCAATCTGCAAATGCCGTCCTCGCCGTATCAGGTAATGGCCGGGACGG
TGATGGCTGGGGCGCTGGTCACGGGCATCAAGTCCGATTTGCCGGGCGACGTGATCGCCACGGTGACGGA
GCCGGTCTATGACTCGGCTACGGGCAAGTTCCTGCTGATCCCACAGGGATCGCGCATCCTGGGCAAGTAC
AACAGCCAGGTGAGCTACGGGCAGAGCCGCGTGCAGGTGGTGTGGAACCGCGTCATCCTGCCGGACACGT
CATCGCTGAAGCTCGACAACCTGGCGGGCACCGACCCTGCCGGCTACGCCGGCCTGGAGGATGGCGTCGA
TTGGCATTGGGATCGCGTCTTTGCCGGTGCGGCGCTGACCACGTTGCTGGGCGTGGGCGCCGAACTGGCC
GCGCCGGAGAACCGGCAGAACGGCAATCGCATCGTGATCGCTGGGCGCGACAGCGCACAGGACAGCATCA
ATCAGGTCGGACAGGAGATGACCCGGCGCAACATGAACATCCAGTCGACGCTGACCGAGCGGCCGGGCCT
GCCGGTGCGCATCATCGTCAACCGCGATCTGGTGTTGCGGCCGTACCAGCCGATGTTCTTCCAGCGGGGG
GCCATGCAATGA
 Primer design