SecReT4
Protein ID: 222112659
T4SS name [ID]Trb [357]
Gene symbol-
Locus tagDtpsy_3498
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]3748734..3749726 [-]
Productp-type conjugative transfer protein trbg
Component typeTrbG
UniProt IDB9MII5
KEGG IDdia:Dtpsy_3498
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.7e-67, Aligned region: 104..323
Protein Sequence: 330 a.a.     [Download]
>gi|222112659|ref|YP_002554923.1| p-type conjugative transfer protein trbg [Acidovorax ebreus TPSY]
MNDLFRKSALPVMLLASTVLFSGCATQGKPPPSISLDEPVQAQPLPEPPAPVEVVAVPQVLPMPAQMKPV
PDAKPAAEPADETLRVSRANAEARIAPTREGYVNAIQVWPFTDGALYQVYAAVGRVTVIALQPGEELVTV
AAGDTVRWIVGDTSSGSGDALRVNVMVKPIRSGLKTNLVITTSRRTYLLELTSTEKTWMASVSWEYPKDK
MLALQRQSQVANAAAPVDAGLSLEKIRFRYAVSGSNPPWKPLRAFDDGEKVYIQFPPGIAQGELPPLFVI
GAQGDGQLVNYRFRAPYYIVDRLFGAAELRLGGDKGDVVRIERTDGTRRN
 
Nucleotide Sequence: 993 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c3749726-3748734 Acidovorax ebreus TPSY chromosome, complete genome
ATGAATGATCTTTTCCGTAAATCCGCCTTGCCGGTGATGCTTCTGGCTTCGACCGTGCTGTTCTCTGGTT
GCGCCACGCAGGGCAAGCCGCCGCCGTCCATTTCGCTCGATGAGCCGGTGCAGGCCCAGCCACTGCCGGA
GCCGCCTGCGCCTGTGGAGGTGGTGGCCGTGCCGCAGGTGCTGCCGATGCCGGCGCAGATGAAACCTGTG
CCGGATGCCAAGCCCGCCGCAGAACCCGCCGATGAAACCTTGCGGGTGTCCCGCGCCAACGCCGAGGCGC
GCATTGCGCCCACGCGCGAAGGCTACGTCAATGCGATTCAGGTGTGGCCCTTCACGGATGGCGCGCTGTA
CCAGGTCTATGCGGCCGTGGGCCGCGTGACCGTGATCGCGCTCCAGCCCGGTGAGGAACTGGTGACGGTG
GCCGCAGGCGATACCGTGCGCTGGATCGTGGGCGACACATCGAGCGGCAGCGGTGATGCGCTGCGCGTCA
ATGTGATGGTCAAACCGATCCGCTCGGGCCTCAAGACCAATCTGGTCATCACGACCAGCCGTAGGACGTA
CCTGCTGGAGCTGACCTCGACCGAGAAGACGTGGATGGCGTCGGTGTCCTGGGAGTATCCGAAGGACAAG
ATGCTGGCCTTGCAGCGCCAGTCGCAGGTGGCCAATGCCGCCGCGCCAGTCGATGCCGGGCTGTCGCTGG
AGAAGATCCGTTTCCGCTACGCCGTCAGCGGCAGCAATCCGCCCTGGAAGCCGCTGCGCGCTTTCGACGA
CGGCGAGAAGGTCTACATCCAGTTTCCGCCGGGCATTGCCCAAGGCGAGTTGCCGCCGCTGTTCGTGATC
GGCGCGCAGGGCGACGGGCAACTGGTGAACTACCGCTTCCGCGCGCCGTACTACATCGTGGATCGGCTGT
TTGGCGCGGCCGAGCTGCGCCTGGGCGGAGACAAGGGCGATGTGGTGCGGATCGAGCGCACGGACGGCAC
GCGGAGGAACTGA
 Primer design