SecReT4
Protein ID: 222112660
T4SS name [ID]Trb [357]
Gene symbol-
Locus tagDtpsy_3499
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]3749723..3750427 [-]
Productconjugal transfer protein Trbf
Component typeTrbF
UniProt IDB9MII6
KEGG IDdia:Dtpsy_3499
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-61, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|222112660|ref|YP_002554924.1| conjugal transfer protein Trbf [Acidovorax ebreus TPSY]
MRFKRPQVRYADTPQPATPYQSAAQIWDERIGSARVQAKNWRFMAFGCLTLAVLMAGGLVWRSAQSIVTP
YVIEVDNAGQVRAVGEAATPYRPSDAQIAYHLGRFIGLVRSLSIDPIVVRQNWLDAYDYTTDKGAVVLNE
YARVNDPFARIGKESVTVQISSVTRASDTSFNVRWTETRFVNGALDRTERWNAVVSIVQQTPRTEQRLRK
NPLGIYVNGLSWSRELEGNEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c3750427-3749723 Acidovorax ebreus TPSY chromosome, complete genome
ATGCGATTCAAACGACCGCAGGTGCGCTACGCCGACACGCCGCAGCCTGCCACCCCATACCAGTCCGCCG
CCCAAATCTGGGACGAGCGCATCGGCTCGGCCCGCGTGCAGGCGAAGAACTGGCGCTTCATGGCCTTTGG
CTGCCTCACCTTGGCCGTGCTGATGGCCGGCGGGCTGGTGTGGCGTTCGGCGCAGTCCATCGTGACGCCC
TACGTCATTGAGGTGGACAACGCGGGCCAGGTGCGTGCTGTCGGCGAAGCCGCCACGCCGTACCGGCCCA
GCGATGCGCAGATCGCCTACCACCTGGGCCGCTTCATCGGCCTGGTGCGCTCGCTGTCCATCGACCCGAT
CGTGGTGCGGCAGAACTGGCTCGATGCCTACGACTACACGACCGACAAGGGCGCGGTCGTGCTCAACGAG
TACGCCCGTGTGAACGATCCGTTCGCGCGCATCGGCAAGGAGTCGGTGACGGTGCAGATCAGCAGCGTGA
CCCGTGCCAGCGACACCTCGTTCAACGTGCGCTGGACGGAGACGCGCTTTGTGAACGGTGCGCTGGATCG
CACCGAACGTTGGAATGCCGTGGTTTCCATCGTGCAGCAGACGCCGCGCACCGAGCAGCGCCTGCGCAAG
AACCCCCTGGGCATCTACGTCAATGGGCTGTCATGGAGCCGCGAACTGGAAGGAAACGAAGGAGCAAAAC
CATGA
 Primer design