SecReT4
Protein ID: 222112661
T4SS name [ID]Trb [357]
Gene symbol-
Locus tagDtpsy_3500
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]3750446..3751798 [-]
Productconjugal transfer protein Trbl
Component typeTrbL
UniProt IDB9MII7
KEGG IDdia:Dtpsy_3500
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.6e-48, Aligned region: 37..264
Protein Sequence: 450 a.a.     [Download]
>gi|222112661|ref|YP_002554925.1| conjugal transfer protein Trbl [Acidovorax ebreus TPSY]
MNDVTVIDRFLDTFSRYIDSGFGLLHGEVAFLTATLIVIDMTLAGLFWAMSHATGQGEDVIAKLIRKVLY
VGAFAYIIGNFNWLVGIVFRSFAGLGLTASGSTLSMENFLQPGRLAKVGIDAGAPILKQIGDMAGFPEVF
VNITPIVVMFLAWLIVLLCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTAFLAEKVLGNVVSSGIK
VLVLAVIVGIGSGLFAEFQVQPAEPSIDHSVVVMLASLTLLALGIFGPGIATGLVSGGPQLGAGAMAGAA
LGAAGAAVAVGAAATGVGGAVAAGARMAPAAARLAGSGARAATGAASSARSAFQAGSASAGGGLRGTAAG
VGNVAKTGAQAAGQKVAEGARSMREHVAAAFRPDDAGSASGAGAAQAANEPTPSTAQPAWAKRLHRRQQL
THAATTAAHTLRGGDGGSSSQGPSLRDSDS
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c3751798-3750446 Acidovorax ebreus TPSY chromosome, complete genome
ATGAACGACGTGACGGTCATCGACCGCTTCCTCGACACCTTCTCGCGCTACATCGACTCGGGCTTTGGCC
TGTTGCACGGCGAAGTGGCGTTTCTGACCGCCACGCTGATCGTCATCGACATGACGCTCGCCGGGCTGTT
CTGGGCGATGAGCCATGCCACCGGCCAGGGCGAGGACGTGATCGCCAAGCTGATCCGCAAGGTGCTGTAC
GTCGGCGCCTTCGCCTACATCATCGGCAACTTCAACTGGTTGGTCGGCATCGTGTTCCGCTCCTTCGCCG
GGCTGGGCCTGACGGCCAGCGGCTCGACCTTGAGCATGGAGAACTTCCTGCAACCGGGCCGGCTGGCGAA
GGTCGGCATCGACGCCGGGGCGCCGATCCTGAAACAGATCGGCGACATGGCGGGCTTTCCCGAAGTGTTC
GTGAACATCACGCCCATCGTCGTGATGTTCCTCGCGTGGCTGATCGTCCTGCTGTGCTTCTTCGTGCTGG
CGATCCAGCTTTTCATCACGCTGATCGAGTTCAAGCTAACAACGCTCGCGGGCTTCGTGCTGGTGCCGTT
CGCGCTGTGGAACAAGACGGCGTTCCTGGCCGAGAAGGTACTTGGCAACGTGGTGTCGTCAGGCATCAAG
GTGCTGGTGCTCGCGGTCATCGTCGGCATCGGCTCCGGGCTGTTCGCCGAGTTTCAGGTGCAGCCGGCCG
AGCCATCCATCGACCACTCCGTGGTCGTGATGCTGGCCTCGCTGACCCTGTTGGCGCTGGGCATCTTCGG
GCCGGGCATTGCGACCGGGCTGGTGTCCGGCGGGCCGCAGCTCGGCGCGGGTGCGATGGCCGGTGCCGCT
CTGGGTGCGGCCGGTGCTGCTGTTGCCGTGGGCGCCGCAGCCACGGGCGTCGGCGGTGCAGTCGCCGCCG
GGGCGCGCATGGCGCCCGCAGCCGCCAGGCTGGCGGGCAGCGGAGCGCGGGCCGCCACCGGAGCCGCCAG
CAGCGCACGGTCAGCGTTTCAGGCGGGTTCTGCATCCGCTGGCGGTGGCCTCAGGGGCACAGCCGCCGGC
GTGGGCAATGTCGCCAAGACCGGCGCACAGGCGGCCGGGCAGAAGGTGGCCGAAGGCGCGCGCTCGATGA
GGGAGCATGTCGCTGCTGCCTTCCGGCCCGACGACGCCGGATCGGCTTCGGGGGCCGGCGCCGCGCAGGC
GGCAAACGAGCCAACCCCATCCACTGCGCAACCCGCCTGGGCCAAGCGTCTGCATCGCAGACAGCAGCTC
ACCCATGCCGCGACGACTGCCGCCCACACGCTGCGCGGCGGCGATGGCGGTAGTTCCAGCCAGGGGCCAA
GCCTTCGTGATTCCGATTCCTGA
 Primer design