SecReT4
Protein ID: 222112663
T4SS name [ID]Trb [357]
Gene symbol-
Locus tagDtpsy_3502
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]3752115..3752870 [-]
Productconjugal transfer protein Trbj
Component typeTrbJ
UniProt IDB9MII9
KEGG IDdia:Dtpsy_3502
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 251 a.a.     [Download]
>gi|222112663|ref|YP_002554927.1| conjugal transfer protein Trbj [Acidovorax ebreus TPSY]
MKLHTPKLAALTAACVLAFGIAQPAHALFGVGDIVLDPTNLVQNTLTAVRTLEQINNQIRQLQNEAQMLI
NQARNLASLPSSVVGQLRENLATTQRLIAQAKGLAYDVTSIDREFARLYPEKYAATVSGNQMYLDAQERW
KNTLNGLQTTMQMQAQASQNLSDDESVLADLVGKSQSAEGALQAMQAMNQLLALQAKQSIQTQRLQITQD
RAASLELARQAAATERGREVTRRFLGEGTPYTPQPVNFYNR
 
Nucleotide Sequence: 756 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c3752870-3752115 Acidovorax ebreus TPSY chromosome, complete genome
ATGAAATTGCATACCCCCAAACTCGCCGCGCTGACCGCTGCCTGCGTGCTCGCCTTCGGCATCGCACAGC
CTGCGCACGCGCTGTTCGGCGTCGGCGACATCGTGCTCGATCCGACCAATCTGGTGCAAAACACGCTCAC
GGCGGTTCGCACACTGGAGCAGATAAATAACCAGATCCGCCAGCTCCAGAACGAAGCGCAAATGCTCATC
AACCAGGCGCGCAATCTGGCCAGCCTGCCGTCCAGTGTGGTCGGCCAGTTGCGCGAGAACCTGGCGACCA
CCCAGCGACTGATCGCGCAGGCCAAGGGCTTGGCCTACGACGTGACAAGCATCGACCGCGAATTCGCGCG
TCTGTACCCCGAGAAGTACGCCGCCACGGTGAGCGGCAATCAGATGTACCTCGATGCGCAGGAGCGTTGG
AAGAACACGCTCAACGGCCTGCAAACCACCATGCAGATGCAGGCCCAGGCGTCGCAGAACCTGAGCGATG
ACGAAAGCGTGCTGGCCGACCTCGTGGGCAAGAGCCAGTCGGCCGAGGGCGCGCTGCAAGCGATGCAGGC
CATGAACCAATTGCTGGCCTTGCAGGCCAAGCAGTCCATCCAGACGCAGCGGCTCCAGATCACGCAAGAC
CGCGCGGCCTCGCTGGAACTAGCTCGGCAAGCGGCGGCCACGGAGCGCGGACGCGAGGTGACGCGCCGTT
TCCTGGGTGAAGGCACGCCGTACACGCCGCAGCCCGTCAATTTCTACAACCGCTGA
 Primer design