SecReT4
Protein ID: 222112664
T4SS name [ID]Trb [357]
Gene symbol-
Locus tagDtpsy_3503
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]3752867..3755338 [-]
Productconjugal transfer ATPase Trbe
Component typeTrbE
UniProt IDB9MIJ0
KEGG IDdia:Dtpsy_3503
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.6e-39, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 7.5e-17, Aligned region: 299..388
DUF853 [PF05872], Evalue: 8.8e-05, Aligned region: 613..684
Protein Sequence: 823 a.a.     [Download]
>gi|222112664|ref|YP_002554928.1| conjugal transfer ATPase Trbe [Acidovorax ebreus TPSY]
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRRLG
SGWALFIEAERRSAADYPHSDFPEPLSWLVDEERRAAFEDSGNHFESGYHLTLAYLPSEESRARAAGLLY
ENRPTEGVDWRERLHAFVAETDRIFDLLDGVMPEIAWLDDSQTLTYLHSTISTRRYRVGVPEVPFHIDAL
LTDSALVGGLAPMLGDQHLRVVSVRGFPTSTWPGILDDLNRLGFAYRWSTRFLCLDKAEAEKELARLRRQ
WFAKRKNVIALLRETIFQQESPLVDTDANNKAADADAALQELGSDQVAFGYLTATVTVMDADAAVADEKL
RMVERVIQGRGFVTIPEALNAVDAWLSSLPGNAYANVRQPIVSTLNLAHMMPVSAVWAGPEKNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGNTLVVGPIGMGKSVLLATMAMQFRRYRGSRIFAFDMGRSIRAAILGMG
GEHYDLGADDEIAFQPLARIDREGYRTWASEWVEGRLLHEGAAVGPDEKAAIWSALGSLASAPVEQRTLT
GLTALLQSNTLRQALAPYVLGGAHGRLLDADHDRLGTADVQAFEMEELMHSKAAVLAVLRYLFARFEERL
DGAPTLLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADVKDSAIAPAIIESCASRIFLPN
PQATEPQIRTIYEGFGLNSRQIEIVATAQPKRDYYYQSRLGNRVFDLDLGPATLAFAGASTPQDQRAIDE
VLGRVPQDAGVSGFAGAWLRHRGLDWAADLLPSFPGLAPGSLRTADHPQENQP
 
Nucleotide Sequence: 2472 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c3755338-3752867 Acidovorax ebreus TPSY chromosome, complete genome
ATGCTGAACCTCGCCGAATACCGCCAGCGCCCGGCCTTGCTCGCCGACTGGCTGCCCTGGGCCGGGCTGG
TGGCGCCGGGCGTCGTCTTGAACAAGGACGGCAGTTTCCAGCGCACGGCGCGCTTTCGTGGCCCCGACCT
CGACAGCGCGACGCAGGGCGAGCTGATCGCCACGTCGGCGCGCTTGAACAACGCGCTGCGTCGCCTGGGT
TCGGGTTGGGCGCTGTTCATCGAAGCCGAGCGCCGGTCTGCCGCCGACTACCCGCACTCCGATTTCCCCG
AACCGCTGTCCTGGCTGGTCGATGAAGAACGCCGCGCCGCCTTCGAGGATTCGGGCAACCACTTCGAGAG
CGGCTATCACCTGACGCTGGCCTACCTGCCGTCCGAGGAATCCCGTGCCCGCGCCGCGGGCCTGCTGTAT
GAAAACCGGCCGACCGAAGGCGTGGATTGGCGCGAACGGCTGCACGCCTTCGTCGCTGAAACGGATCGCA
TCTTCGACCTGCTCGATGGCGTGATGCCGGAGATCGCATGGCTTGATGACAGCCAGACGTTGACCTACCT
GCATTCGACCATCTCGACGCGCCGCTACCGCGTCGGCGTTCCCGAAGTGCCGTTCCACATCGACGCGCTG
CTGACGGACTCCGCACTGGTCGGCGGCCTGGCGCCCATGCTGGGTGACCAGCACCTGCGCGTGGTGTCGG
TGCGCGGTTTCCCGACTTCGACCTGGCCGGGGATTCTGGACGACCTCAACCGCCTGGGCTTCGCGTATCG
CTGGAGTACGCGCTTTCTGTGCCTCGACAAAGCCGAGGCGGAAAAAGAACTCGCCCGCCTGCGCCGCCAG
TGGTTTGCGAAAAGGAAGAACGTCATCGCGCTGCTGCGCGAGACGATCTTCCAGCAGGAAAGCCCGCTGG
TCGATACCGACGCCAACAACAAGGCCGCCGACGCCGATGCTGCCTTGCAGGAACTGGGCAGCGATCAAGT
CGCCTTCGGCTACCTGACGGCGACCGTCACCGTCATGGACGCGGACGCCGCCGTGGCCGACGAGAAGCTG
CGGATGGTGGAGCGTGTGATTCAGGGCCGGGGTTTCGTGACGATCCCCGAAGCGCTCAACGCCGTGGATG
CGTGGCTGTCCTCGCTCCCCGGCAATGCATACGCCAACGTGCGCCAGCCCATCGTCTCGACGCTGAATCT
GGCGCACATGATGCCGGTGTCGGCGGTATGGGCCGGGCCGGAGAAGAACGATCACCTCGACGGCCCGCCG
CTGATCGTGACGCGCACCGATGGCGCCACGCCGTTCCGACTGGTGACGCACATCGGCGACGTGGGCAACA
CTCTGGTGGTTGGCCCCATCGGCATGGGCAAGTCGGTGCTGCTGGCGACGATGGCGATGCAGTTCCGCCG
CTATCGCGGCTCGCGCATCTTCGCCTTCGACATGGGGCGCTCGATCCGTGCGGCCATCCTGGGAATGGGC
GGCGAGCACTACGACCTGGGCGCGGATGACGAGATCGCCTTCCAGCCGCTGGCTCGCATCGACCGCGAGG
GCTACCGCACCTGGGCCAGCGAATGGGTGGAAGGCCGCCTGCTGCACGAAGGCGCGGCCGTCGGCCCCGA
CGAGAAGGCGGCCATCTGGTCTGCGTTGGGGAGCCTGGCCAGCGCGCCGGTGGAGCAGCGCACGCTCACG
GGCCTGACGGCCTTGCTGCAATCGAATACCTTGCGCCAGGCACTCGCGCCCTACGTCCTGGGCGGTGCGC
ACGGCAGGCTGCTGGATGCCGACCACGACCGCCTCGGCACGGCCGACGTGCAGGCGTTCGAGATGGAGGA
GCTGATGCACAGCAAGGCCGCTGTGCTCGCGGTGCTGCGCTATCTGTTCGCGCGCTTCGAGGAGCGGCTG
GATGGTGCGCCCACGTTGCTGATCCTTGATGAAGCGTGGCTGTTCCTCGATGACCCGGTATTCGCGGCGC
GCATCCGCCAGTGGCTCAAGACGCTGCGCAAGAAGAACGTCAGCGTCATCTTCGCTACGCAGTCGCTCGC
GGACGTGAAGGACTCGGCCATCGCACCCGCAATCATCGAAAGCTGCGCGAGTCGGATTTTCTTGCCGAAC
CCGCAAGCGACCGAACCGCAGATTCGCACGATCTACGAAGGCTTCGGCCTCAACAGCCGACAGATCGAGA
TTGTCGCCACCGCGCAGCCCAAGCGCGACTACTACTACCAATCCCGCCTCGGCAACCGCGTGTTCGACCT
CGACCTGGGGCCGGCGACGCTGGCCTTCGCGGGCGCTTCCACGCCGCAAGACCAGCGCGCCATTGATGAG
GTTCTTGGCCGCGTGCCGCAGGACGCTGGCGTGTCCGGCTTCGCGGGCGCCTGGCTGCGCCATCGCGGCC
TCGATTGGGCGGCTGACCTGCTGCCCTCGTTCCCCGGCCTCGCGCCGGGTTCCCTCCGTACCGCTGACCA
CCCCCAGGAGAACCAACCATGA
 Primer design