SecReT4
Protein ID: 222112665
T4SS name [ID]Trb [357]
Gene symbol-
Locus tagDtpsy_3504
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]3755353..3755625 [-]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDB9MIJ1
KEGG IDdia:Dtpsy_3504
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 8e-11, Aligned region: 6..84
Protein Sequence: 90 a.a.     [Download]
>gi|222112665|ref|YP_002554929.1| conjugal transfer protein TrbD [Acidovorax ebreus TPSY]
MSGPDTFAAGFEVPLHRSLTEPILLGGAPRTVAIANGTLAAAVGLGLQLWIPGVVLWIVGHSLAMWGARV
DPQFMAVFARHIKHRPLLDV
 
Nucleotide Sequence: 273 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c3755625-3755353 Acidovorax ebreus TPSY chromosome, complete genome
ATGAGCGGCCCGGACACCTTCGCGGCCGGGTTCGAGGTGCCGCTGCATCGCTCACTGACCGAGCCGATCC
TGCTGGGCGGTGCGCCGCGCACCGTGGCGATCGCCAATGGCACGCTGGCCGCCGCTGTCGGCCTGGGCCT
GCAACTGTGGATTCCCGGTGTCGTGCTCTGGATCGTCGGCCATTCGCTGGCGATGTGGGGCGCGCGCGTC
GATCCGCAGTTCATGGCCGTGTTCGCGCGGCACATCAAGCACCGCCCGTTGCTGGACGTGTAG
 Primer design