SecReT4
Protein ID: 222112666
T4SS name [ID]Trb [357]
Gene symbol-
Locus tagDtpsy_3505
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]3755622..3756008 [-]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDB9MIJ2
KEGG IDdia:Dtpsy_3505
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.2e-24, Aligned region: 27..118
Protein Sequence: 128 a.a.     [Download]
>gi|222112666|ref|YP_002554930.1| conjugal transfer protein Trbc [Acidovorax ebreus TPSY]
MTHVDAFRISVYPLSRRSSPARLDGLARPAMQGLMLAAFMLLLAGTAQAAGSSMPWEGPLQSILESIQGP
VARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 387 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c3756008-3755622 Acidovorax ebreus TPSY chromosome, complete genome
ATGACGCACGTTGATGCTTTCCGTATTTCTGTATATCCGCTTTCCCGCCGCTCCAGCCCCGCACGGCTGG
ATGGCTTGGCTCGCCCGGCCATGCAAGGCTTGATGCTCGCTGCCTTCATGCTGCTGCTTGCGGGCACTGC
GCAGGCCGCCGGCTCCTCGATGCCCTGGGAAGGCCCGCTGCAATCCATCCTCGAATCCATCCAGGGGCCG
GTGGCGCGCATCGTCGCGGTCATCATCATCATCGCCACGGGCCTCGCGCTCGCGTTCGGTGACACGTCGG
GCGGCTTTCGCAAGCTGATCCAGATCGTGTTTGGCCTGTCCATCGCGTTCGCGGCTTCGAGTTTCTTCCT
GTCGTTCTTCAGCTTCTCGGGCGGGGCCGTCGTATGA
 Primer design