SecReT4
Protein ID: 222112667
T4SS name [ID]Trb [357]
Gene symbol-
Locus tagDtpsy_3506
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]3756005..3757039 [-]
Productp-type conjugative transfer ATPase trbb
Component typeTrbB
UniProt IDB9MIJ3
KEGG IDdia:Dtpsy_3506
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.6e-81, Aligned region: 26..292
FtsK_SpoIIIE [PF01580], Evalue: 1.4e-06, Aligned region: 144..208
TrwB_AAD_bind [PF10412], Evalue: 1.8e-06, Aligned region: 145..185
Protein Sequence: 344 a.a.     [Download]
>gi|222112667|ref|YP_002554931.1| p-type conjugative transfer ATPase trbb [Acidovorax ebreus TPSY]
MSAAPSSFATSLDRRIQMLRTAMGPLIAAALEDPDVVEVMLNPDRTLWVDRLSSGRAPMGVELSEADGER
IIRLVAAHVGAEVHRGQPLLSAELPETGERFEGILPPAAPGPAFALRKRAIGVIPLERYVIDGMMTSAQA
GFLVRAVRERQNVLIAGATSSGKTTLANALLAEIAATGDRVLVLEDTVELQCAARDHVPLRTRAGVVSMT
ELVRSSMRLRPDRVVVGEVRGAEALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAVNPPRALI
AEAVNVVIHIAGRGRKRRIESIARVVGFDGAGYRLADAMDAPFPELLPQSDLSSLSPDHSGELP
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c3757039-3756005 Acidovorax ebreus TPSY chromosome, complete genome
ATGAGCGCCGCGCCTTCGTCCTTTGCCACCTCGCTCGACCGCCGCATTCAGATGCTGCGCACGGCGATGG
GGCCGTTGATCGCCGCCGCGCTCGAAGACCCGGACGTGGTGGAAGTGATGCTCAATCCCGACCGGACGTT
ATGGGTGGATCGCCTGTCCTCGGGCCGCGCGCCGATGGGCGTGGAGCTGTCCGAAGCAGACGGCGAGCGA
ATCATCCGCCTTGTGGCCGCCCACGTTGGCGCAGAAGTACATCGCGGCCAGCCGTTGCTGTCCGCCGAGT
TGCCCGAGACGGGCGAACGCTTCGAGGGCATCTTGCCGCCGGCTGCGCCGGGGCCGGCCTTCGCGCTGCG
CAAGCGCGCCATCGGCGTGATTCCGCTGGAGCGGTACGTCATCGACGGAATGATGACCAGCGCGCAGGCG
GGCTTTCTCGTTCGCGCTGTGCGCGAGCGCCAGAACGTGCTGATCGCCGGCGCTACCAGCAGCGGCAAGA
CCACGCTCGCCAATGCGCTGCTGGCCGAGATTGCCGCCACGGGCGACCGCGTGCTGGTGCTCGAAGACAC
GGTGGAACTGCAATGCGCGGCCCGCGACCACGTGCCGCTGCGCACGCGGGCGGGCGTGGTGTCGATGACC
GAGCTGGTGCGCTCATCCATGCGCCTGCGCCCGGATCGCGTTGTCGTCGGCGAAGTGCGCGGCGCTGAAG
CGCTGGATCTCATCAAGGTGTGGGGCACCGGCCATCCGGGCGGCATCGCCACGATCCACGCCGGCTCCGC
GCTGGGCGCACTGCTGCGCCTGGAGCAACTGATTCTCGAAGTGGCGGTGAACCCGCCCCGTGCGCTGATC
GCGGAAGCGGTCAATGTGGTGATCCACATCGCCGGGCGCGGACGCAAGCGCCGCATCGAGAGCATCGCCC
GCGTCGTCGGCTTCGACGGTGCGGGCTACCGACTGGCGGATGCGATGGACGCGCCGTTTCCCGAGCTGCT
GCCGCAGTCCGACCTTTCTTCCTTGTCCCCTGACCACTCTGGAGAACTGCCATGA
 Primer design