SecReT4
Protein ID: 222112669
T4SS name [ID]Trb [357]
Gene symbol-
Locus tagDtpsy_3508
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]3757497..3759500 [-]
Productconjugal transfer coupling protein trag
Component typeTraG
UniProt IDB9MIJ5
KEGG IDdia:Dtpsy_3508
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1e-102, Aligned region: 111..559
TraG-D_C [PF12696], Evalue: 8.4e-31, Aligned region: 404..524
TrwB_AAD_bind [PF10412], Evalue: 1.2e-29, Aligned region: 172..539
Protein Sequence: 667 a.a.     [Download]
>gi|222112669|ref|YP_002554933.1| conjugal transfer coupling protein trag [Acidovorax ebreus TPSY]
MQGTNVLFGQIAVVFGIVITGVWAATQWTAAALGYQLRLGSPWFDFFDTPIYHPWRLFEWWFFFDAYAPR
VFDIGGAIAGGSGLVAVLVAIGMSIWRSRQSRLVTTYGSARWANADDIRKAGLTQPTGVFLGQHDRQYLR
HEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWSITAGWRSRFSHCLLFNPTDAKSAAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALERRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPA
CPFELTLHRMMTTPHLGDGPHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLIAAEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIARRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGPNHSILDNCHVRVTFATNDERTAKRISETLGTATELRAQRN
YAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDEAVVMVSSVAPIKARKLRYYADSNFKRRVLPPPV
LTAGRYADVPPSRPDDWSGLAIPAVPATPATASTDGLGSADDDGGPRRQPELSEAVAYDPEQTTPAADLA
LLDDDDDLPLPLPRQLDPAMQRTARLASLDPNDGIEL
 
Nucleotide Sequence: 2004 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c3759500-3757497 Acidovorax ebreus TPSY chromosome, complete genome
ATGCAAGGGACGAACGTGCTGTTCGGTCAGATCGCCGTGGTGTTCGGCATCGTGATCACCGGCGTGTGGG
CGGCCACACAATGGACAGCCGCCGCCCTGGGCTATCAGCTACGCCTTGGCTCGCCCTGGTTCGACTTCTT
CGACACGCCCATCTATCACCCGTGGCGGCTGTTCGAGTGGTGGTTCTTCTTCGATGCCTACGCGCCGCGC
GTCTTTGACATCGGTGGTGCCATCGCGGGAGGCAGCGGCCTCGTGGCCGTGCTGGTCGCCATTGGCATGT
CGATCTGGCGCTCGCGGCAATCGCGCCTGGTCACGACCTACGGCTCGGCACGCTGGGCGAACGCGGATGA
CATTCGTAAGGCCGGGCTCACGCAGCCGACCGGCGTGTTCCTGGGCCAGCACGATCGCCAGTACCTGCGG
CACGAAGGCCCGGAACACGTTCTGACCTTCGCGCCCACACGCTCGGGCAAAGGCGTGGGCCTGGTGGTGC
CGACACTGTTGAGCTGGCCTGCTTCCGCTGTCATCCACGACATCAAGGGCGAGAACTGGAGCATCACCGC
AGGCTGGCGTTCGCGCTTCTCGCACTGCCTGCTGTTCAACCCCACCGATGCGAAGTCGGCAGCCTACAAC
CCGCTGCTGGAAGTCCGCCGTGGCGCGCATGAAGTGCGCGACGTTCAGAACATCGCGGACATCCTGGTCG
ATCCCGAAGGCGCGCTGGAGCGACGCAATCACTGGGAAAAGACTTCGCACGCGCTGCTGGTCGGCGCAAT
CCTGCATGTGCTCTACGCGGGCGAGGACAAGACGCTGCGCGGTGTCGCCAACTTCCTCAGTGACCCTGCC
TGCCCGTTCGAGCTGACCCTGCACCGGATGATGACCACGCCGCATCTCGGCGATGGCCCGCATCCGGTCG
TGGCCTCGGCGGCGCGTGAGGTACTGAACAAATCGGACAACGAACGCTCCGGCGTGCTGTCCACGGCCAT
GTCGTTCTTGGGCCTGTACCGCGACCCCACGGTGGCCGAAGTCACCTCGCGCTGCGATTGGCGCATCGCT
GACCTGATCGCGGCCGAGCATCCGGTGTCGCTGTACCTGGTGGTGCCGCCTTCGGACATTTCGCGGACGA
AGCCGCTGATTCGCCTGATCCTCAACCAGATCGGGCGGCGGCTGACGGAATCGCTTGATGGCTCCGACGG
CATCGCGCGCCGCCACAAGCTACTGCTGATGCTCGACGAGTTCCCGGCCTTGGGGCGCCTGGACTTCTTC
GAGACGGCGCTGGCCTTCATGGCGGGCTACGGCATCCGCAGCTTCCTCATCGCGCAGTCGCTCAACCAGA
TTGACAAGGCCTACGGCCCGAACCATTCGATCCTGGACAACTGCCACGTGCGCGTGACCTTCGCCACCAA
TGACGAGCGCACCGCCAAGCGCATTTCCGAGACGCTGGGCACCGCGACCGAGCTGCGCGCGCAACGCAAC
TACGCGGGCCACCGACTCGCGCCGTGGCTGGGCCACCTGATGGTGTCGCGGCAGGAGACGGCCCGGCCGC
TCCTGACGCCCGGCGAAGTCATGCAGCTCCCGCCTGACGAGGCGGTGGTGATGGTGTCCAGCGTGGCCCC
CATCAAGGCCAGGAAGCTGCGCTACTACGCAGACAGCAATTTCAAACGCCGCGTGTTGCCGCCGCCCGTG
CTCACGGCCGGGCGCTATGCCGACGTGCCGCCATCGCGGCCCGACGACTGGAGCGGGCTGGCGATTCCCG
CCGTGCCCGCCACACCGGCCACTGCGTCCACTGACGGCCTGGGCAGCGCCGACGACGACGGCGGCCCGCG
CCGTCAGCCTGAGCTTTCCGAGGCCGTCGCCTACGACCCCGAGCAGACCACGCCCGCGGCCGACCTCGCG
TTGCTCGATGACGACGACGACCTGCCGCTCCCCCTTCCTCGCCAGCTTGATCCGGCCATGCAGCGCACGG
CCCGGCTGGCTTCTCTCGACCCCAACGACGGAATCGAGCTATGA
 Primer design