SecReT4
Protein ID: 222475649
T4SS name [ID]VirB [419]
Gene symbolvirD4
Locus tagAMF_992
StrainAnaplasma marginale str. Florida
Repliconchromosome [GenBank: NC_012026] [Browse all T4SS(s) in this replicon]
Location [Strand]1159067..1161487 [-]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDB9KHA6
KEGG IDamf:AMF_992
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.6e-150, Aligned region: 124..568
TraG-D_C [PF12696], Evalue: 1.7e-26, Aligned region: 407..529
TrwB_AAD_bind [PF10412], Evalue: 1.2e-25, Aligned region: 240..543
Protein Sequence: 806 a.a.     [Download]
>gi|222475649|ref|YP_002564066.1| type IV secretion system component VirD4 [Anaplasma marginale str. Florida]
MHSSSNHIRNILVFFFGMFFLLEFCFYISGALFVLSMWGLEYLDFNALNPSISDFPMRLWPTIFNYIHGW
WADPKLYGVSNSLKLWLSFAAPLCIVGTVFWNLRHILLEWRPFRKKEALHGDSRWASERDIRKIGLRSRK
GLLLGKDQRGYLVADGYQHALLFAPTGSGKGVGFVIPNLLFWEDSLVVHDIKLENYDITSGWRKKIGQEV
YVWNPAQPDGVSHCYNPLDWISKKPGQMVDDVQKIANLIMPEQDFWYNEARSLFVGVVLYLLAVPEKVKS
FGEVVRTMRSDDVVYNLAVVLDTIGKKIHPVAYMNIAAFLQKADKERSGVVSTMNSSLELWANPLIDTAT
ASSDFNIQEFKKKKITVYVGLTPDNLTRLRPLMQVFYQQATEFLCRALPSDDEPYGVLFMMDEFPTLGKM
EQFQTGIAYFRGYRVRLFLIIQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLIGNKTVS
QESLNRPKFLDLNPASRSLHISDTQRALLLPQEVIMLPKDEQILLIESTYPIKSKKIKYYEDKFFTKKLL
KSTFVPTQEPYDPDAARGGVDTVAEDVPTSEEGEQQAAIAHEESAQEAQQPQEQHGDEAGYDEFGDYPQD
YDYSSEDDEYMEGLDDIEGEDVPLNGEGLDDIGDEDSYPEDHVSDEGHPEEDELSAYKEEPTDSELQDAE
DGYGGGDEEPYYEENDGGEPYEADEIRGSEGGVTDVYPEEDEPLAYEEEPTDGELQDAEDEYGSGDEEPY
YEESGGDEPYGEDETYDDEDTQPPRRDGKQRDDDNP
 
Nucleotide Sequence: 2421 bp     [Download]
>gi|222474741|ref|NC_012026.1|:c1161487-1159067 Anaplasma marginale str. Florida, complete genome
ATGCACAGTAGCTCTAATCACATACGTAACATTTTGGTGTTCTTCTTCGGGATGTTTTTCCTCCTGGAGT
TCTGTTTTTACATCTCGGGGGCACTTTTTGTTCTTTCAATGTGGGGTCTTGAGTACCTGGATTTCAACGC
TTTGAACCCCAGTATATCAGACTTCCCCATGAGGTTATGGCCAACAATTTTCAATTACATCCACGGGTGG
TGGGCCGACCCCAAGTTATATGGGGTGTCTAATTCGCTGAAGTTGTGGCTATCCTTCGCGGCACCGTTGT
GTATAGTGGGCACTGTCTTTTGGAATCTGCGGCACATTCTCCTGGAGTGGCGGCCGTTTCGAAAGAAAGA
GGCCTTGCATGGTGATTCCAGATGGGCGTCGGAGCGCGATATACGTAAAATTGGCCTCAGAAGCAGGAAG
GGTTTGCTGCTTGGAAAAGACCAAAGGGGGTATTTAGTAGCAGACGGCTATCAGCACGCATTGCTTTTTG
CGCCTACAGGGTCAGGTAAAGGTGTGGGGTTTGTAATACCCAATCTTCTGTTCTGGGAAGACTCGCTCGT
GGTGCATGACATCAAGCTGGAGAACTACGACATCACGAGTGGGTGGCGCAAGAAGATCGGGCAAGAAGTT
TACGTGTGGAACCCGGCACAGCCCGACGGCGTTAGCCACTGTTATAACCCTCTAGACTGGATTAGCAAAA
AGCCCGGCCAAATGGTGGATGACGTGCAAAAAATTGCGAACCTCATCATGCCTGAGCAAGATTTCTGGTA
CAACGAGGCGCGGAGTCTTTTCGTCGGCGTTGTTTTGTATCTGCTTGCAGTGCCGGAAAAGGTCAAATCA
TTTGGTGAAGTCGTGCGCACAATGCGCAGTGACGATGTGGTTTATAACCTGGCCGTGGTTTTGGATACCA
TAGGGAAAAAAATCCATCCAGTAGCATATATGAACATTGCGGCCTTCCTCCAGAAGGCCGATAAGGAGCG
GTCAGGTGTGGTCTCAACAATGAACTCATCCCTGGAACTGTGGGCCAACCCCTTGATTGACACTGCAACC
GCGTCTAGTGACTTCAACATTCAGGAGTTCAAGAAGAAGAAGATCACAGTATACGTGGGCCTCACCCCAG
ATAACCTGACCAGGCTCAGGCCTCTGATGCAGGTGTTTTATCAGCAGGCGACCGAGTTTTTGTGTAGGGC
GTTGCCATCGGACGATGAGCCCTATGGGGTGTTGTTTATGATGGATGAGTTCCCCACGCTAGGAAAAATG
GAGCAATTCCAAACCGGTATCGCGTACTTCCGCGGCTATAGAGTTAGGCTGTTCTTGATAATACAAGATA
CCGAGCAGCTGAAGGGTATATACGAAGAGGCGGGTATGAACTCCTTCCTCTCAAACTCTACTTATAGGAT
CACATTTGCGGCAAATAATATTGAAACTGCAAACTTGATTTCTCAGCTCATAGGTAACAAAACCGTGAGT
CAGGAATCGCTGAATAGGCCGAAATTTTTGGATTTGAATCCTGCATCGCGTTCTCTGCACATTTCAGATA
CTCAACGGGCGCTGTTGCTTCCACAGGAAGTGATCATGCTACCGAAAGATGAGCAGATTTTATTGATCGA
ATCTACGTATCCGATCAAATCGAAAAAGATTAAGTACTATGAGGATAAGTTCTTCACTAAGAAGCTACTC
AAGAGCACTTTTGTCCCGACGCAGGAACCTTATGATCCAGATGCGGCACGGGGAGGAGTGGACACAGTCG
CTGAGGATGTGCCTACATCTGAAGAAGGAGAGCAGCAGGCTGCCATTGCTCATGAAGAAAGCGCTCAGGA
GGCGCAGCAACCCCAAGAACAACACGGTGATGAGGCTGGGTACGACGAATTCGGAGATTATCCACAAGAC
TATGACTACAGCTCAGAAGATGATGAGTACATGGAAGGTCTGGATGACATAGAAGGAGAGGATGTACCAC
TAAACGGAGAAGGCCTGGACGATATAGGTGACGAAGACAGCTACCCGGAAGATCACGTTAGCGACGAAGG
ACATCCGGAAGAGGATGAACTCTCTGCGTATAAAGAAGAGCCCACCGATAGTGAGCTGCAAGATGCCGAA
GATGGGTATGGTGGCGGAGATGAAGAGCCGTATTACGAGGAAAATGACGGTGGTGAGCCGTATGAGGCAG
ATGAAATACGCGGTTCAGAAGGCGGGGTCACTGACGTGTATCCGGAGGAGGATGAACCCCTAGCATATGA
AGAGGAGCCCACTGATGGTGAGCTGCAAGATGCCGAAGACGAGTATGGCAGCGGAGATGAAGAGCCGTAT
TATGAAGAAAGTGGCGGCGATGAGCCGTACGGGGAAGACGAAACATACGATGACGAAGATACACAACCCC
CCCGTCGCGACGGCAAGCAGCGTGATGATGACAACCCGTAA
 Primer design