SecReT4
Protein ID: 222475650
T4SS name [ID]VirB [419]
Gene symbolvirB11
Locus tagAMF_993
StrainAnaplasma marginale str. Florida
Repliconchromosome [GenBank: NC_012026] [Browse all T4SS(s) in this replicon]
Location [Strand]1161535..1162548 [-]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDB9KHA7
KEGG IDamf:AMF_993
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2e-87, Aligned region: 17..317
Protein Sequence: 337 a.a.     [Download]
>gi|222475650|ref|YP_002564067.1| type IV secretion system ATPase VirB11 [Anaplasma marginale str. Florida]
MLCAHMTAGYAALETYLEPLQSIFAEDGVNEISINRECEVWVENRGDIRCERIESLTLSHLKALGRLVAQ
ATEQKLSEETPLLSASLPNGFRVQVVFPPACEGDKVVFSIRKPSTVQLSLDDYEKMGAFSHVAQQGRKAM
DVNKQLSELLDSGDIKSFIELAVLSKKNIIVSGGTSTGKTTFTNAALRVIPKDERIITVEDSREIALDHP
NRVHLLASKGGQGRAKVSTQDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADTPRMA
VEQLKLMVMQASLGLPPDQIVSYITNIVDVIIQLKRESGGVRHVAEIMFTKCSQGND
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|222474741|ref|NC_012026.1|:c1162548-1161535 Anaplasma marginale str. Florida, complete genome
GTGTTGTGTGCGCATATGACAGCAGGATACGCAGCGTTAGAAACATACTTGGAGCCCCTGCAGAGCATAT
TCGCGGAGGATGGGGTCAATGAGATCTCGATCAACAGGGAATGCGAGGTATGGGTAGAGAACAGGGGCGA
TATACGGTGTGAGAGGATTGAAAGTCTAACTCTGTCGCATCTAAAAGCACTCGGCAGGTTGGTAGCACAA
GCAACCGAGCAGAAATTGAGTGAGGAAACGCCTTTGCTGTCGGCTTCTTTGCCCAACGGCTTCCGCGTGC
AGGTGGTGTTTCCCCCCGCTTGCGAGGGTGATAAAGTCGTATTTTCCATAAGAAAGCCATCGACGGTGCA
GTTGTCGCTCGATGATTATGAAAAAATGGGTGCGTTCTCCCATGTGGCCCAGCAGGGCCGCAAGGCTATG
GACGTAAACAAGCAGCTTAGTGAGCTCCTGGATAGCGGGGATATCAAATCTTTCATAGAGCTTGCGGTGC
TGAGCAAAAAAAACATAATCGTCAGTGGAGGTACGTCCACTGGGAAAACTACGTTCACAAACGCGGCGCT
GCGGGTCATCCCAAAGGATGAAAGGATAATAACGGTGGAAGACTCTAGAGAAATAGCGCTAGACCACCCC
AACAGGGTACATCTATTGGCATCCAAGGGCGGCCAGGGGCGCGCTAAGGTCTCTACACAAGATCTCATAG
AGGCCTGCTTGCGTCTTCGTCCAGATAGAATAATTGTGGGGGAGCTCAGGGGGGCTGAGGCGTTTAGCTT
TCTCAGAGCCATAAATACCGGGCACCCGGGTTCCATCTCCACCTTGCATGCAGACACGCCTAGAATGGCT
GTAGAGCAGCTGAAACTTATGGTAATGCAAGCGAGTCTAGGGTTGCCGCCAGACCAAATAGTAAGTTACA
TTACCAACATAGTAGACGTAATTATACAGCTGAAAAGGGAGTCTGGAGGGGTGCGGCACGTCGCGGAGAT
TATGTTCACTAAATGTTCACAAGGCAATGATTAA
 Primer design