SecReT4
Protein ID: 222778503
T4SS name [ID]VirB [398]
Gene symbol-
Locus tagCla_a016
StrainCampylobacter lari RM2100
Repliconplasmid megaplasmid pCL2100 [GenBank: NC_012040] [Browse all T4SS(s) in this replicon]
Location [Strand]19359..19967 [+]
Productconjugal transfer protein TraJ/VirB8
Component typeVirB8
UniProt IDB9KGI1
KEGG IDcla:Cla_a016
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.4e-58, Aligned region: 2..200
Protein Sequence: 202 a.a.     [Download]
>gi|222778503|ref|YP_002576140.1| conjugal transfer protein TraJ/VirB8 [Campylobacter lari RM2100]
MIEKSNQRAWLVAFISMAISIIAVIAVIFLTPLKTTEPYVIRVDNTTGMVDIITSLQEEQISSIEALDKY
FISQYIKAREGYYYKFLNQDYVLTQLMSDENVANEYRAIYAGDNALDQIYKDNVEVRVKILSIVLGNSNG
VKTSTIRALITKKDSVTKSTQQSTKVITLAYDFLLAKTSEENRILNPLGFKVTNYRVDEEIR
 
Nucleotide Sequence: 609 bp     [Download]
>gi|222778487|ref|NC_012040.1|:19359-19967 Campylobacter lari RM2100 megaplasmid pCL2100, complete sequence
TTGATTGAAAAATCAAATCAAAGAGCTTGGTTAGTTGCATTTATAAGTATGGCAATATCAATTATTGCTG
TAATTGCTGTAATTTTCTTAACACCATTAAAAACTACCGAACCTTATGTGATTAGAGTAGATAATACTAC
TGGTATGGTGGATATTATTACTAGCTTACAAGAAGAGCAAATTAGTTCTATTGAAGCTTTAGACAAATAC
TTTATCTCTCAATATATAAAAGCTAGAGAAGGTTATTATTATAAGTTTTTAAATCAAGATTATGTTCTTA
CTCAATTAATGAGTGATGAAAATGTTGCAAATGAGTATAGAGCTATCTATGCTGGCGATAATGCTTTAGA
TCAAATTTATAAAGATAATGTTGAAGTAAGAGTTAAGATTTTAAGTATTGTTCTTGGAAATAGCAATGGA
GTAAAAACCTCTACTATAAGAGCATTAATTACTAAAAAAGATTCTGTAACAAAAAGCACACAGCAATCAA
CCAAAGTTATAACTTTGGCGTATGATTTTTTACTAGCAAAAACAAGTGAAGAAAATAGAATTTTAAACCC
TCTTGGCTTTAAGGTTACTAACTATAGAGTTGATGAGGAAATAAGATGA
 Primer design