SecReT4
Protein ID: 222778506
T4SS name [ID]VirB [398]
Gene symbol-
Locus tagCla_a019
StrainCampylobacter lari RM2100
Repliconplasmid megaplasmid pCL2100 [GenBank: NC_012040] [Browse all T4SS(s) in this replicon]
Location [Strand]22071..23072 [+]
Productconjugal transfer protein VirB11
Component typeVirB11
UniProt IDB9KGI4
KEGG IDcla:Cla_a019
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 8.5e-66, Aligned region: 18..313
FtsK_SpoIIIE [PF01580], Evalue: 2.2e-05, Aligned region: 155..182
Protein Sequence: 333 a.a.     [Download]
>gi|222778506|ref|YP_002576143.1| conjugal transfer protein VirB11 [Campylobacter lari RM2100]
MSNSRTLEKLANDFFGKHLANSSVTEICYNGKKNIFIQTNDGKWQEETSKLDYEASKSFATSLASFKEDK
IDESRPILSCILHGGERVQVVIPPATKKEHISITIRKPSEKRFLIQDHVKSGLFEEIKTDHFITNPLDEE
LKKLYEAKNFKDFICKAVEYEKNIIIAGGTGSGKTTFMKTLIDFIPKEQRIITIEDVEEIKFYEHKNFVQ
LFYPSEAKNEDFLNSATLLKSCLRMKPDRILLAELRGAETYDFINVLSSGHGGSITSCHAGSTSETFERL
ALMTLQNTQGQKIPFEKIQDMLKNLIDVVVHIRAHNGKRHISQIYFKEMKNGK
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|222778487|ref|NC_012040.1|:22071-23072 Campylobacter lari RM2100 megaplasmid pCL2100, complete sequence
ATGAGTAATTCAAGAACCCTAGAAAAATTAGCTAATGATTTTTTTGGAAAGCATTTGGCTAATTCCAGCG
TAACTGAAATATGCTACAACGGCAAAAAAAATATTTTCATACAAACTAATGATGGAAAATGGCAAGAAGA
AACAAGTAAGTTAGATTATGAAGCTTCTAAGTCGTTTGCTACTTCTTTAGCTTCTTTTAAAGAAGATAAG
ATAGATGAATCACGCCCTATCCTTTCTTGTATATTACATGGAGGTGAAAGGGTTCAGGTAGTAATTCCGC
CAGCGACTAAAAAAGAGCATATTTCAATTACAATTAGAAAACCAAGTGAGAAAAGATTTTTAATACAAGA
TCATGTTAAAAGTGGTCTTTTTGAAGAAATAAAAACTGATCATTTTATAACAAATCCTTTGGATGAGGAG
TTGAAAAAGCTTTATGAGGCTAAAAATTTTAAAGATTTTATTTGTAAAGCAGTAGAGTATGAAAAAAATA
TCATTATAGCAGGAGGTACAGGAAGCGGTAAAACAACTTTTATGAAAACTTTAATTGATTTTATTCCCAA
AGAACAAAGAATTATAACTATAGAAGATGTTGAAGAAATAAAATTTTATGAGCATAAAAATTTTGTACAA
CTTTTTTATCCCAGTGAAGCTAAAAATGAAGATTTTTTAAATTCTGCAACTCTTTTAAAATCGTGTCTTA
GAATGAAGCCTGATAGAATCTTATTGGCAGAGCTTAGAGGTGCTGAAACTTATGATTTTATCAATGTTCT
TTCTAGTGGGCATGGTGGTAGCATTACAAGTTGCCATGCAGGAAGCACTTCTGAAACATTCGAGCGTTTG
GCTTTGATGACTTTACAAAATACTCAAGGTCAAAAAATACCTTTTGAAAAAATACAAGATATGCTTAAAA
ATCTTATTGATGTAGTTGTCCATATTAGAGCTCATAATGGAAAAAGACATATTAGTCAAATATATTTTAA
AGAGATGAAGAATGGCAAATAA
 Primer design