SecReT4
Protein ID: 222778508
T4SS name [ID]VirB [398]
Gene symbol-
Locus tagCla_a021
StrainCampylobacter lari RM2100
Repliconplasmid megaplasmid pCL2100 [GenBank: NC_012040] [Browse all T4SS(s) in this replicon]
Location [Strand]23627..25423 [+]
Productconjugal transfer protein TraG/VirD4
Component typeVirD4
UniProt IDB9KGI6
KEGG IDcla:Cla_a021
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.5e-103, Aligned region: 92..561
TraG-D_C [PF12696], Evalue: 3.1e-23, Aligned region: 405..523
TrwB_AAD_bind [PF10412], Evalue: 2.2e-16, Aligned region: 149..241
TrwB_AAD_bind [PF10412], Evalue: 2.2e-16, Aligned region: 307..535
Protein Sequence: 598 a.a.     [Download]
>gi|222778508|ref|YP_002576145.1| conjugal transfer protein TraG/VirD4 [Campylobacter lari RM2100]
MKDKIVMLVFISLFSLLIAYFLSPFVMFYLNDVSLKRILGFYNLKFTFEALINAYPKAYISFFGMFGFSV
IVLMLLALIAKSKKTQFGEARFANLAEIKKMKLFSDNGIIIGKYKGKFLRFKGPQFVALGAPTRSGKGVG
IVIPNLMDWKESAVVQDIKQECFDFTSKYRKEVLGQDVFLFNPFSKRTHRYNPLTYIDMSDSDNCDSQLM
DLANIIYPKEGDSTTQFFNGLAQNLFIGLCYLWKDLNLKEDGKLFLETFNLKTEFSFFGILQLSKGFTFE
YEGKKINGFDNTYKYLSNCDDLLSDITKRRLETYFSISSDNTKSGVMSSFNEPLTPFEAEVLKLSTQTSD
FDLRDLRKKKMTIYIGITPDQLTNAKFILNIFWSQLILLNTKELPEQNPQIKYTCLMLMDEFTAPRKIPI
YLSAVSFMAGYLMRSLMIYQSKSQLKAPAPDGYGDDGAKTLLTNHACQIFYTPREQEDAEEISRILGNTT
FKTRSRSVGASGGSTSYSEASRALMLPQELREMSFEDELITIDNGKPILCKKAFYYNDPYFIDKFKQVSP
TLAKIKGIPKEHILKGAFQRGECRIQIPTTGENNEKNA
 
Nucleotide Sequence: 1797 bp     [Download]
>gi|222778487|ref|NC_012040.1|:23627-25423 Campylobacter lari RM2100 megaplasmid pCL2100, complete sequence
ATGAAAGATAAGATTGTAATGCTTGTTTTTATAAGTCTTTTTTCACTATTAATAGCTTATTTTTTAAGTC
CTTTTGTGATGTTTTATCTTAATGATGTAAGCTTAAAAAGAATTCTTGGGTTTTACAATCTTAAATTCAC
TTTTGAGGCATTAATAAATGCTTACCCAAAAGCTTATATTTCTTTCTTTGGTATGTTTGGTTTTAGTGTT
ATTGTTTTAATGCTTTTAGCGTTAATAGCTAAAAGCAAAAAAACTCAATTTGGCGAGGCAAGATTTGCAA
ATTTAGCAGAAATTAAAAAAATGAAATTATTTTCAGACAATGGAATAATCATCGGAAAATATAAGGGAAA
ATTTTTAAGATTTAAAGGGCCTCAGTTTGTGGCTTTGGGAGCTCCAACAAGAAGTGGTAAAGGGGTTGGT
ATTGTAATACCAAATTTAATGGACTGGAAAGAGAGTGCTGTTGTTCAGGATATAAAACAAGAATGTTTTG
ATTTTACAAGTAAATATAGAAAAGAAGTTTTGGGTCAAGATGTTTTTCTTTTTAATCCATTTTCAAAAAG
AACTCATCGTTACAACCCTTTAACTTATATAGATATGAGTGATAGTGATAATTGTGATAGTCAGTTAATG
GATTTAGCAAATATCATTTATCCAAAAGAAGGGGATTCTACAACTCAATTCTTTAATGGTCTTGCACAAA
ACCTATTTATAGGACTTTGTTATTTGTGGAAAGATTTAAATTTAAAAGAAGATGGGAAACTTTTTTTAGA
AACATTTAACTTAAAAACAGAATTTAGTTTTTTTGGAATATTACAACTTTCAAAAGGTTTTACTTTTGAA
TATGAGGGTAAAAAAATAAATGGATTTGATAATACTTATAAGTACTTATCAAATTGTGATGATCTACTTT
CAGATATCACCAAAAGAAGGCTAGAGACTTATTTTAGTATTTCAAGTGATAATACAAAATCAGGAGTTAT
GTCTTCTTTTAACGAGCCTTTAACCCCTTTTGAAGCAGAGGTATTAAAACTTTCTACTCAAACTAGTGAT
TTTGATTTGAGAGATTTACGCAAAAAGAAAATGACTATTTATATAGGCATAACCCCTGATCAATTAACTA
ATGCAAAATTTATATTAAATATTTTTTGGTCGCAGTTAATTCTTTTGAATACAAAAGAACTTCCTGAACA
AAATCCACAAATTAAATATACTTGTTTAATGCTTATGGATGAATTTACAGCACCTAGAAAAATTCCTATA
TATCTTTCAGCAGTAAGTTTTATGGCAGGTTATTTAATGCGTTCTTTGATGATTTATCAATCAAAATCTC
AACTTAAAGCACCTGCCCCTGATGGATATGGGGATGATGGAGCAAAAACTCTTTTGACTAACCATGCTTG
TCAAATTTTTTATACCCCAAGAGAGCAAGAAGATGCAGAGGAGATTAGTAGAATACTTGGTAATACTACA
TTTAAAACAAGATCAAGAAGTGTAGGGGCAAGTGGTGGATCTACAAGTTATAGTGAAGCAAGTAGGGCAT
TAATGCTTCCACAAGAACTTCGAGAAATGTCTTTTGAAGATGAGCTTATTACTATAGATAATGGAAAGCC
TATTTTATGCAAAAAAGCTTTTTATTATAACGATCCATATTTTATTGATAAGTTTAAACAAGTCTCTCCA
ACTTTGGCAAAAATTAAAGGCATACCTAAAGAACATATCTTAAAAGGAGCTTTTCAAAGAGGAGAGTGTC
GCATACAAATACCAACAACAGGAGAAAATAATGAAAAAAACGCTTAG
 Primer design