SecReT4
Protein ID: 224586101
T4SS name [ID]Tfc [757]
Gene symbolpilL
Locus tagSPC_4402
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4511005..4512249 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDC0Q5B2
KEGG IDsei:SPC_4402
PDB IDNA
Domain hit(s) vs Pfam TcpQ [PF10671], Evalue: 9.6e-25, Aligned region: 324..411
Protein Sequence: 414 a.a.     [Download]
>gi|224586101|ref|YP_002639900.1| hypothetical protein SPC_4402 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MNTQALFCLSLPLVIAGCAQQTSTQTARDSAFAQSQQPSVFSDIYQRSPEVTRSGRYTLVSIKSADAQRE
PLNQLIDITMPGQLVNSVGDGFRYLLFQSGYSLCGHYGADFSELLNRPLPAVQRKIGPMRLSEALQVVAG
PAWRMSVDEVNREVCFVLRDAYRVQAKTKALTSVTPAVTGAARTSSPETTRNPYTGVLPGNKAEPVIAGQ
HLAAKKGTELKPVSQSLPVPALRPGGTPVTSGVSSAPPVKQVSSPAPRNPFTGKNLTGTTLSASHSPAPV
GEKAQAKTPSPSTVKAVNPATATVLATTTKPLTGTPVAAVASGPEWKAVVGSTLKESLTDWAGRADCPGG
GHWVVIWQTPTDYRIDAPLVFKGNFETALVQVFDLYKKADKPLFAEASRLQCLVSVADKPADRS
 
Nucleotide Sequence: 1245 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4511005-4512249 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGAACACACAAGCGCTTTTCTGCCTGAGCCTGCCGCTGGTGATTGCCGGGTGTGCACAGCAGACCTCCA
CCCAAACCGCTCGCGACAGCGCATTTGCACAGAGTCAGCAGCCTTCCGTCTTCTCTGATATTTACCAGCG
ATCACCGGAGGTGACTCGCAGCGGGCGTTACACGCTGGTCAGTATTAAAAGTGCGGATGCGCAGCGGGAA
CCGCTCAACCAGCTCATCGATATTACTATGCCAGGGCAACTGGTTAACTCAGTCGGTGACGGATTTCGCT
ACCTGCTGTTTCAGTCTGGTTATTCCCTGTGCGGACATTATGGTGCTGACTTTTCTGAGCTGCTGAACCG
GCCGTTACCGGCCGTTCAGCGCAAAATTGGGCCGATGCGACTCAGTGAGGCACTGCAGGTGGTCGCCGGT
CCTGCCTGGCGAATGTCCGTGGATGAAGTCAACCGGGAGGTCTGTTTCGTATTGCGTGATGCATATCGGG
TACAGGCTAAAACTAAAGCACTGACATCTGTCACACCCGCCGTGACCGGCGCCGCAAGAACCTCCTCCCC
GGAAACCACCCGCAATCCTTATACCGGCGTTCTGCCGGGGAATAAAGCTGAACCCGTGATCGCCGGCCAG
CACCTGGCGGCGAAGAAAGGTACTGAACTGAAACCGGTCAGTCAGTCACTTCCTGTCCCTGCCCTGAGAC
CTGGTGGGACACCGGTAACGTCAGGAGTGTCCTCTGCCCCCCCCGTGAAACAAGTCTCTTCTCCGGCTCC
GCGCAATCCGTTCACAGGAAAAAACCTGACCGGGACCACCCTGTCGGCGTCTCATTCACCGGCGCCTGTG
GGAGAGAAGGCTCAGGCTAAAACACCGTCTCCCTCAACCGTTAAGGCTGTAAATCCGGCGACGGCTACGG
TACTGGCCACGACAACAAAACCGTTAACCGGTACGCCTGTAGCTGCAGTGGCCAGTGGCCCTGAGTGGAA
GGCGGTTGTCGGCAGCACGCTCAAAGAGTCCCTGACTGACTGGGCCGGAAGAGCTGACTGTCCGGGGGGA
GGACACTGGGTGGTTATCTGGCAGACCCCTACGGATTACCGCATTGACGCACCGTTGGTATTTAAAGGCA
ACTTTGAGACGGCGCTGGTTCAGGTGTTTGACCTTTATAAGAAAGCTGACAAGCCCTTATTTGCTGAAGC
TTCCCGCCTGCAGTGCCTGGTTTCAGTTGCGGATAAACCGGCTGACCGGTCGTAG
 Primer design