SecReT4
Protein ID: 224586109
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4414
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4522507..4523247 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDC0Q5C0
KEGG IDsei:SPC_4414
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 246 a.a.     [Download]
>gi|224586109|ref|YP_002639908.1| hypothetical protein SPC_4414 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MKPMKSTLNCLQQWTASVMLAVIVSLPALASVSTGRSVSAPQQQNTTTEGRTQTSGTAWGLSEKEWQQYQ
QVLKGPRAFQSPGIDPLMALGLEAGSASERRRFAEMWVKEEYARGEKELAFQREVDAAWKRLYPNTLSVN
MGNASGIVHDTQGRLALFVKRNCVPCDARVSAVLADNRPVDIYLVDSGGSDDTIRQWALAHHIPVDKVRS
RQITLNHDNGNWLKYGQGYMPVMLQQGVSGWQIAAF
 
Nucleotide Sequence: 741 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4522507-4523247 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGAAACCGATGAAATCAACGTTAAATTGCCTCCAGCAGTGGACTGCGTCAGTCATGCTGGCTGTTATCG
TAAGTCTGCCTGCTCTTGCATCAGTGAGTACGGGTCGCAGTGTAAGCGCACCCCAGCAGCAAAATACGAC
TACAGAAGGAAGGACGCAAACGTCAGGAACGGCATGGGGACTCAGCGAAAAAGAATGGCAGCAGTATCAA
CAGGTACTTAAAGGTCCCAGAGCATTTCAGTCACCTGGCATTGACCCGTTGATGGCACTGGGGCTGGAGG
CCGGTTCGGCAAGCGAACGCCGGCGTTTTGCTGAAATGTGGGTGAAGGAAGAGTATGCCCGGGGTGAAAA
GGAGCTGGCCTTTCAGCGGGAAGTGGATGCTGCCTGGAAACGCCTTTATCCCAATACTCTCTCCGTAAAC
ATGGGCAATGCCAGCGGTATTGTCCATGATACACAGGGAAGACTGGCGTTATTTGTGAAGCGCAACTGTG
TACCGTGCGATGCCAGAGTAAGTGCGGTTCTGGCAGATAACCGTCCGGTTGATATTTACCTGGTCGACAG
TGGCGGCAGTGATGACACCATTCGCCAGTGGGCGCTTGCACATCATATTCCGGTCGATAAAGTTCGTAGC
CGGCAGATAACCCTCAACCACGATAACGGCAACTGGCTGAAGTATGGTCAGGGATATATGCCGGTTATGC
TTCAGCAGGGAGTCTCCGGATGGCAAATCGCAGCATTCTGA
 Primer design