SecReT4
Protein ID: 224586110
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4415
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4523361..4523912 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDC0Q5C1
KEGG IDsei:SPC_4415
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 183 a.a.     [Download]
>gi|224586110|ref|YP_002639909.1| hypothetical protein SPC_4415 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MATEVGVPAEALYSVSLAETSRKLPHGERPWPWTLNVAGKGYRYNSRQEAYDAMLSFMRRYPLKRIDVGI
AQVNLGWNGTYFSSYYEALDPYTNLRVAARILKSCYDNNPGSWIQAAGCYHHPAGGKPARIYKSIVKRKL
ATLDLNAPVTYSELQIAQISPSQRHFSHYNRELQWVEPRESRQ
 
Nucleotide Sequence: 552 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4523361-4523912 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
GTGGCAACTGAAGTCGGCGTACCCGCTGAAGCCCTGTATTCAGTTTCTCTTGCAGAAACATCCCGAAAAC
TACCACATGGAGAGCGACCGTGGCCGTGGACACTCAATGTTGCCGGGAAAGGGTATCGGTATAACTCCCG
CCAGGAAGCGTATGACGCAATGTTGTCGTTCATGCGTCGCTATCCGTTAAAGCGGATTGATGTTGGGATC
GCGCAGGTTAACCTGGGCTGGAATGGAACTTATTTCAGCAGTTACTACGAAGCGCTGGATCCATATACCA
ACCTTCGGGTTGCCGCCCGTATTCTTAAATCCTGTTATGACAACAATCCGGGAAGCTGGATACAGGCCGC
GGGGTGTTATCACCATCCTGCAGGTGGAAAACCAGCACGAATCTATAAGTCCATCGTGAAACGCAAGCTG
GCAACACTGGATTTAAACGCGCCAGTAACGTACTCCGAACTTCAGATCGCACAGATATCGCCATCACAGC
GCCATTTCTCACACTACAACCGTGAATTGCAATGGGTTGAACCCAGGGAGTCCCGTCAGTGA
 Primer design