SecReT4
Protein ID: 224586111
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4416
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4523948..4524448 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDC0Q5C2
KEGG IDsei:SPC_4416
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.2e-49, Aligned region: 17..164
Protein Sequence: 166 a.a.     [Download]
>gi|224586111|ref|YP_002639910.1| hypothetical protein SPC_4416 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MVSILLTTSSMAALNVIADLGGEPTAPLFDAINNKNNEFTPPRSLNATGASVTAAPADVSDMLPVTTPEM
RAGKVEARELNLNGMTPVFLVGDDSLSREWLTMRRDELKRLHATGLVVNVSDKDALSELQQIIPDVILLP
ASASEIARRLHLNHYPVLITATGLAQ
 
Nucleotide Sequence: 501 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4523948-4524448 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGGTCAGTATTTTGCTGACAACATCATCGATGGCAGCACTCAATGTGATTGCTGATCTTGGCGGAGAAC
CAACAGCGCCGCTTTTTGATGCCATCAATAATAAGAACAACGAGTTCACTCCGCCGAGGTCACTGAACGC
CACGGGCGCGTCTGTAACCGCAGCCCCTGCGGATGTAAGTGATATGCTGCCCGTAACCACACCGGAAATG
CGTGCAGGGAAAGTGGAAGCCCGTGAGTTAAATCTGAACGGGATGACACCGGTCTTTCTTGTTGGGGATG
ATTCGCTTTCACGCGAGTGGTTGACGATGCGGCGTGATGAGCTTAAGCGACTTCATGCTACAGGTCTGGT
GGTGAATGTCAGCGATAAGGACGCGTTGTCGGAACTTCAGCAAATCATACCTGATGTCATTCTGCTACCG
GCATCGGCAAGCGAAATAGCGCGTCGTTTGCATCTCAACCACTACCCGGTGTTGATTACCGCCACCGGTC
TGGCCCAGTAG
 Primer design