SecReT4
Protein ID: 224586113
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4418
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4525047..4527137 [+]
Producthypothetical protein
Component typeTfc6
UniProt IDC0Q5C4
KEGG IDsei:SPC_4418
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 5e-19, Aligned region: 503..632
TrwB_AAD_bind [PF10412], Evalue: 7.5e-14, Aligned region: 178..225
TrwB_AAD_bind [PF10412], Evalue: 7.5e-14, Aligned region: 493..642
AAA_10 [PF12846], Evalue: 1.2e-08, Aligned region: 188..578
T4SS-DNA_transf [PF02534], Evalue: 2.1e-05, Aligned region: 187..641
Protein Sequence: 696 a.a.     [Download]
>gi|224586113|ref|YP_002639912.1| hypothetical protein SPC_4418 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MSNRYVMEALLRPAVELYSAAAGGAATFVLVVAPWSMALAPQVSYVTAAGFAIFTTIRTRQGLRILRYRR
NIRRLPRYQMSSESIPVSRHFLFLGKGFMWEQKHTQRLLETKRPEVAPFLKPSVFYSLARQFERRYEYTF
PGLCSLTRRDSFFNPVRPLPPVGGNSAIHGVEMEEDNVLMSLTERVGHLLVLGTTRVGKTRLAELLITQD
IRRGNVTIVFDPKGDADLLKRMWAETRRAGRSDEFYIFHLGWPDISARYNAVGRFGRVSEVASRVAGQLG
GEGNNAAFKEFAWRFVNIIARALVVLGLRPDYSLILRYVTNIAELYETYAEKLLTQQAPELWLMVQNQMG
ILTEDDLPRTMQGQVNAIRVMAIEVALSSEQGKKIYDPVLDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKTAALLSPDYSDMNDPRPLIDWQEIIRKGGVVYVGLDALSDSEVASAVGNSMFADLVSTAGYIYKFGLS
DDMPEGSSQRLPISLHCDEFNELMGEEFIPMINKGGGAGIEVTAYTQTWSDIEAKIGNAAKAAQVTGNFN
NMIMLRVREKTTAELLTTQLPEVEIYTKTLVSGVTDISNPDQGSDFTSNVQDRVSSTRVPLLSPAEVMNL
PKGQAFALLEGGRLWKIRMPLPASVDDEMMPVNLQSIVTTMRKHYRTGDTWWSGSVLPGDNLVDAL
 
Nucleotide Sequence: 2091 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4525047-4527137 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGAGTAACCGTTATGTCATGGAGGCGTTATTGAGGCCAGCAGTAGAACTCTATTCAGCTGCGGCTGGCG
GGGCTGCCACTTTTGTTCTGGTTGTCGCACCATGGTCGATGGCGTTAGCACCACAGGTCAGTTATGTGAC
TGCAGCCGGTTTTGCCATTTTCACAACAATCAGAACTCGTCAGGGTTTGCGCATCTTGCGCTATCGACGC
AATATCCGTCGGTTACCCCGGTATCAGATGTCCAGTGAATCCATACCGGTAAGCCGACATTTTTTGTTTC
TGGGGAAAGGCTTTATGTGGGAGCAAAAGCATACCCAACGTTTGCTTGAGACGAAACGGCCGGAAGTTGC
TCCCTTTCTGAAACCGTCAGTTTTTTACTCCCTGGCTCGTCAGTTTGAACGACGGTATGAGTATACATTC
CCTGGGTTATGTAGCCTGACAAGACGAGATTCATTTTTTAATCCGGTACGCCCATTACCCCCTGTTGGTG
GTAATTCGGCGATACATGGTGTCGAGATGGAGGAAGATAATGTTTTGATGAGTCTTACCGAGCGCGTTGG
ACATCTTCTTGTATTAGGAACGACACGAGTTGGTAAGACCCGTCTGGCAGAACTGTTAATTACGCAGGAT
ATTCGCAGAGGAAATGTCACTATCGTTTTTGACCCCAAAGGTGATGCTGATCTGTTGAAACGAATGTGGG
CTGAGACGAGGCGAGCTGGGCGTAGCGACGAGTTTTATATCTTTCATCTTGGCTGGCCAGATATCAGTGC
CCGTTATAATGCAGTCGGCCGTTTTGGACGCGTATCTGAAGTGGCCTCACGTGTTGCCGGGCAGCTTGGG
GGAGAAGGAAATAACGCTGCGTTTAAAGAGTTTGCATGGCGCTTTGTCAATATCATCGCTCGTGCTCTTG
TCGTTCTTGGTTTGCGACCTGATTATTCGCTTATCCTCCGGTACGTAACAAATATTGCAGAGCTTTATGA
GACCTATGCCGAGAAGTTACTGACTCAACAGGCTCCGGAGTTGTGGCTGATGGTTCAAAACCAGATGGGG
ATCCTGACTGAGGATGATTTACCACGTACGATGCAGGGACAGGTTAATGCTATTCGGGTTATGGCCATTG
AAGTGGCATTATCCAGTGAGCAGGGCAAAAAAATATACGATCCCGTACTGGATGGGTTGCGTAGCGCTGT
ACGTTATGATCGAACATATTTCGATAAAATAGTCGCTTCATTGTTACCTCTTCTGGAAAAACTGACCACA
GGCAAAACTGCGGCACTATTATCTCCTGACTACAGTGATATGAATGATCCGCGCCCATTAATAGACTGGC
AGGAAATTATACGGAAAGGCGGTGTTGTTTACGTCGGTCTTGATGCTCTTTCAGATTCTGAAGTTGCTTC
TGCGGTAGGTAACAGTATGTTTGCCGATCTGGTTTCAACAGCTGGATATATTTATAAGTTCGGACTGTCT
GATGATATGCCCGAAGGGAGTAGCCAGCGGTTACCCATCAGTCTTCACTGTGATGAATTCAATGAGTTAA
TGGGAGAAGAATTCATTCCGATGATAAATAAAGGCGGTGGGGCAGGTATTGAAGTTACAGCCTATACCCA
GACCTGGTCAGATATTGAGGCCAAAATTGGTAATGCAGCTAAAGCTGCCCAGGTCACAGGCAATTTCAAT
AATATGATTATGCTTCGTGTGAGAGAGAAAACGACAGCTGAGTTGCTGACAACGCAATTACCTGAAGTTG
AAATTTATACAAAAACACTGGTTTCCGGTGTGACAGATATATCCAATCCGGATCAGGGGAGTGATTTCAC
ATCCAACGTTCAGGACAGAGTAAGCAGTACACGTGTTCCTCTTTTATCTCCTGCAGAAGTAATGAATTTA
CCTAAAGGGCAGGCTTTTGCACTGCTGGAAGGAGGGCGATTATGGAAGATTCGTATGCCGCTGCCGGCAT
CCGTTGATGATGAAATGATGCCGGTAAACCTGCAGAGTATTGTCACTACAATGCGTAAACACTACCGAAC
GGGAGACACCTGGTGGTCAGGGAGTGTGCTCCCCGGAGATAATCTGGTGGATGCGCTATGA
 Primer design