SecReT4
Protein ID: 224586114
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4419
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4527332..4527892 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDC0Q5C5
KEGG IDsei:SPC_4419
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 7.3e-63, Aligned region: 1..183
Protein Sequence: 186 a.a.     [Download]
>gi|224586114|ref|YP_002639913.1| hypothetical protein SPC_4419 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MNKELGYLSADFTQSLIFSSPSVTTMGWISSAYQWAFVDSGLLTWIQKEQRETLSSSDSVVFFLGQVQAW
LLSVLSDYLLALVYVTVVFAVRVLILVLSIPLFVLVIIVAVIDGLCRRDLRRYGAGYESSFLYHHAKRFV
KPAVYLPCLLYLSWPASIYPNLLLLPGALLLGLAVTVVTSTFKKYL
 
Nucleotide Sequence: 561 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4527332-4527892 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGAATAAAGAACTTGGCTATTTATCAGCAGATTTTACTCAAAGCCTTATTTTTTCTTCACCATCAGTAA
CTACGATGGGCTGGATTTCGTCAGCTTACCAATGGGCATTTGTGGACAGTGGATTACTCACCTGGATTCA
GAAAGAACAAAGGGAGACATTAAGCAGTTCTGACTCTGTTGTTTTTTTTCTGGGACAAGTGCAGGCCTGG
TTATTATCAGTGTTAAGCGATTATCTGCTTGCGCTGGTTTATGTCACCGTCGTTTTTGCCGTCAGGGTAT
TAATTCTTGTTTTATCCATCCCGTTATTTGTTCTGGTTATCATCGTCGCTGTTATAGACGGGTTGTGTCG
TCGTGACCTGAGACGTTACGGGGCGGGTTATGAGTCGAGTTTTCTGTATCACCATGCCAAACGGTTTGTT
AAACCGGCTGTTTATCTCCCTTGCTTACTTTACTTGTCATGGCCTGCGTCGATTTATCCAAATCTGTTAC
TTCTGCCCGGGGCATTGTTACTGGGACTGGCGGTTACTGTAGTGACATCTACATTCAAAAAATATCTGTG
A
 Primer design