SecReT4
Protein ID: 224586115
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4420
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4528128..4528382 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDC0Q5C6
KEGG IDsei:SPC_4420
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.6e-30, Aligned region: 3..79
Protein Sequence: 84 a.a.     [Download]
>gi|224586115|ref|YP_002639914.1| hypothetical protein SPC_4420 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MVSAAEKDELALALRQLDQVQSALERAKIVAVQDNSDGRFFFDYERATRDLKTMKQGIETYLEPSRAQPR
DKGSLVGQYRKEQP
 
Nucleotide Sequence: 255 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4528128-4528382 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGGTCAGTGCAGCTGAAAAGGATGAACTGGCCCTCGCTCTCAGGCAGCTGGACCAGGTCCAGTCTGCGC
TTGAACGCGCGAAAATTGTAGCGGTACAGGACAATTCTGACGGGCGTTTCTTCTTCGACTATGAGCGGGC
AACACGTGATTTGAAAACCATGAAGCAGGGGATTGAAACTTATCTGGAGCCTTCCCGGGCACAGCCAAGA
GACAAAGGTTCTCTTGTTGGACAATACAGGAAGGAGCAGCCCTGA
 Primer design