SecReT4
Protein ID: 224586117
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4422
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4528699..4529013 [+]
Producthypothetical protein
Component typeTfc10
UniProt IDC0Q5C8
KEGG IDsei:SPC_4422
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 9.5e-32, Aligned region: 16..102
Protein Sequence: 104 a.a.     [Download]
>gi|224586117|ref|YP_002639916.1| hypothetical protein SPC_4422 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MILLLLVASFSSHAGLPTVNIPGGGGGGDMMQTIKLLFSGFLVLMGLIICAVGFYMVSGAILATFSEIRS
GKAEWGKFVAIVVVGIAILVVIVWLCTEAAKILN
 
Nucleotide Sequence: 315 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4528699-4529013 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
TTGATTCTGCTGTTACTGGTGGCGAGCTTCTCCTCTCATGCAGGATTACCTACGGTCAATATTCCCGGTG
GGGGCGGTGGGGGTGACATGATGCAAACGATCAAGCTTCTGTTTTCTGGGTTTCTCGTCCTGATGGGGCT
AATCATTTGTGCTGTCGGATTTTATATGGTTTCCGGCGCTATTCTGGCGACATTCTCAGAAATACGCTCC
GGTAAAGCAGAATGGGGTAAATTTGTTGCGATTGTCGTTGTCGGTATAGCCATTCTCGTTGTCATTGTCT
GGTTGTGTACTGAAGCCGCGAAGATTTTGAATTGA
 Primer design