SecReT4
Protein ID: 224586119
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4424
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4529478..4530047 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDC0Q5D0
KEGG IDsei:SPC_4424
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 6.2e-86, Aligned region: 2..175
Protein Sequence: 189 a.a.     [Download]
>gi|224586119|ref|YP_002639918.1| hypothetical protein SPC_4424 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MILVITGWMRAPSDLTIHNPPDLRSGSTRKWWEVPPSTVYSFAFYIFQQINAWPKDGEKDYPMKIAQLSP
YLTPSCQDFLNKDAELRSQKGELLDRVRVVYEIPKRGYKPESVIIESDDSWEVSLDLVVDEYYHTEPVKR
ALARYPLHIVRWEGDPERNAFGLALDCYKGVPQRLEAAVVPEPEKKGMF
 
Nucleotide Sequence: 570 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4529478-4530047 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
TTGATTCTGGTTATTACAGGATGGATGCGGGCGCCCAGTGACCTGACAATACATAACCCGCCAGATTTAC
GCAGCGGGAGTACGCGTAAATGGTGGGAGGTCCCTCCGAGTACGGTCTACAGCTTTGCCTTTTATATTTT
TCAGCAAATTAATGCCTGGCCGAAGGACGGAGAAAAAGACTATCCGATGAAAATTGCCCAGTTGAGTCCT
TATCTTACGCCATCATGCCAGGATTTTTTGAATAAGGATGCTGAGCTACGGAGTCAAAAAGGTGAGTTGC
TTGATCGCGTTCGCGTCGTTTATGAGATCCCCAAACGTGGTTACAAACCTGAAAGTGTCATCATTGAGAG
CGATGACAGTTGGGAGGTCAGTCTGGATTTGGTAGTCGATGAATACTATCACACAGAACCTGTAAAACGG
GCACTGGCCAGATACCCCCTGCATATTGTCCGCTGGGAAGGTGATCCGGAGCGCAATGCTTTTGGTCTGG
CGCTTGATTGCTATAAAGGCGTCCCACAACGACTTGAAGCTGCAGTGGTCCCTGAGCCAGAGAAAAAGGG
GATGTTTTAA
 Primer design