SecReT4
Protein ID: 224586120
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4425
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4530047..4530946 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDC0Q5D1
KEGG IDsei:SPC_4425
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1.7e-116, Aligned region: 10..294
Protein Sequence: 299 a.a.     [Download]
>gi|224586120|ref|YP_002639919.1| hypothetical protein SPC_4425 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MAMFKVLNFKCKWWPIILLLWFSSAQAVELMKWERIPLLIPLSVNHERIVFVDRNVRVGFPAMLKGKLRV
QSSGGTVYLQASEPFEQTRLQLQDVESGEIILLDIAAKNDNKALEPVRLVYSGEVLSVSEKGMETGSSLP
VASLDTEDKNQTVRKTPVYSAPLPVVLTRYAAQSLYAPLRTVEAVPGIHPVNLRLPSRLTTLYPSENVVV
SPIGAWGIQELNVVALKIRNRSSSKVILDARTLSGSFVSATFQHRWLGAAGTPEDTTTLYLVIRGRPENA
FIAEPAVLPAVKKGEQHAN
 
Nucleotide Sequence: 900 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4530047-4530946 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGGCGATGTTTAAAGTCCTTAATTTTAAGTGTAAATGGTGGCCGATAATTCTCCTTTTATGGTTTTCAT
CAGCACAGGCTGTGGAGCTGATGAAATGGGAACGGATCCCTCTGCTTATTCCACTTTCTGTTAACCATGA
GCGAATTGTCTTTGTCGACCGCAACGTTCGTGTAGGTTTTCCGGCAATGCTCAAAGGTAAACTGAGGGTT
CAAAGCAGCGGTGGTACGGTTTATTTACAGGCCAGCGAACCTTTTGAACAGACCCGACTTCAACTGCAGG
ATGTTGAATCGGGCGAGATTATATTACTGGATATTGCTGCCAAAAATGACAATAAGGCGCTTGAGCCTGT
TCGCCTGGTTTATTCGGGAGAAGTGTTATCGGTGAGCGAAAAAGGAATGGAAACGGGTTCTTCGTTGCCA
GTCGCCTCTTTGGATACAGAAGATAAAAATCAGACTGTCAGAAAAACGCCGGTGTACAGTGCTCCATTGC
CAGTGGTGTTGACTCGTTATGCTGCACAAAGTCTGTATGCCCCTCTACGCACTGTTGAAGCTGTACCCGG
AATTCATCCGGTAAATTTACGCCTTCCCTCGAGACTCACAACTTTATATCCGTCTGAGAATGTAGTTGTT
TCGCCAATAGGGGCATGGGGTATTCAGGAACTGAATGTTGTTGCACTGAAAATCCGGAATCGTTCTTCCT
CCAAAGTGATACTTGATGCCCGGACTTTATCAGGATCGTTTGTCAGTGCGACTTTCCAGCATCGTTGGCT
TGGGGCGGCTGGTACGCCTGAAGATACAACAACTCTTTATCTTGTGATCAGAGGGCGCCCTGAGAATGCC
TTTATTGCTGAACCTGCAGTATTGCCGGCAGTAAAAAAAGGGGAACAGCATGCAAATTAA
 Primer design