SecReT4
Protein ID: 224586121
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4426
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4530960..4532414 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDC0Q5D2
KEGG IDsei:SPC_4426
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 484 a.a.     [Download]
>gi|224586121|ref|YP_002639920.1| hypothetical protein SPC_4426 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MKVLLPVLIVVVCFIGVKACGLKDTTEPEPAKTTNALTELSQDDLKALGIEGDTSADTLRTLIGALRDVR
ARQAVLDEQNKALISENNKLKGENSSVGLQISNAVNAAKQETNEALEKQKTFLLEKLNDLTGTLKSQGQN
TDMVSTGSSSGTDFPVGLGLDPENASSATQGEVIWISPQDAKKTEGQSQSDNDKFTFPTSFLDDNPVSRQ
RAEYDRVVKNKQELDGNGAESDTRPVYTLPENSTLVGSKAMTALIGRIPINDKVTDPYPFKVLIGKDNLT
ANGIELPDVEGAIVSGTATGDMVLSCVRGTIHSITFVFSDGRIRTLPRPVANTQGNNNDNAGDRGSIGWI
SDNNGIPCISGERKSNASTYLPTVALLGMGSSAGDALTQNQYTTQNNVNGGVTSALTGNAGQAVLGQTLG
GGFKEVTDWVKQRYGQTFDAVYVPPGANVAIHITRQLAVDYEDHGRKVRYDFSLPGTGGHYGLD
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4530960-4532414 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGAAGGTTTTACTTCCAGTATTGATCGTGGTGGTTTGTTTTATTGGCGTTAAAGCCTGTGGTTTAAAAG
ATACTACTGAACCTGAACCCGCTAAAACCACTAATGCATTGACTGAGTTGAGCCAGGATGATTTGAAAGC
ACTGGGTATTGAGGGGGATACGTCAGCAGACACGCTACGTACACTTATTGGAGCGTTGCGTGATGTCCGG
GCCCGCCAGGCTGTGCTGGATGAGCAAAATAAGGCACTCATTTCTGAAAATAATAAGCTCAAGGGTGAGA
ATTCATCGGTAGGACTCCAGATATCAAATGCTGTAAATGCCGCAAAACAGGAAACGAACGAGGCTCTTGA
AAAACAGAAAACGTTCCTACTGGAGAAGCTCAATGACCTGACCGGAACACTGAAATCCCAGGGACAAAAC
ACTGACATGGTGTCGACAGGTTCGTCTTCAGGAACCGATTTCCCGGTTGGCCTTGGACTGGATCCAGAGA
ATGCATCCTCTGCAACTCAGGGGGAGGTGATCTGGATATCTCCTCAGGATGCTAAAAAGACAGAGGGTCA
AAGCCAGAGTGATAATGATAAATTCACCTTTCCCACCTCTTTTCTGGATGATAACCCCGTCAGTCGTCAG
CGAGCTGAGTACGATCGCGTTGTTAAAAACAAGCAGGAACTGGACGGAAACGGTGCAGAGTCCGATACAC
GGCCTGTTTATACGTTGCCTGAGAACTCAACCCTGGTAGGCAGTAAGGCGATGACGGCATTAATTGGTCG
TATACCAATTAATGACAAAGTCACCGATCCTTATCCATTTAAAGTCCTGATCGGTAAGGATAACCTAACT
GCAAACGGTATCGAATTGCCCGATGTTGAGGGGGCTATTGTTTCCGGGACTGCTACAGGGGATATGGTGC
TTTCGTGTGTCAGAGGAACGATACATTCGATCACGTTTGTTTTTTCCGATGGACGTATAAGAACACTTCC
CAGACCCGTAGCAAACACTCAGGGCAACAATAATGACAACGCCGGAGACAGGGGCAGCATTGGCTGGATA
TCAGATAACAACGGAATTCCCTGTATCAGTGGTGAGCGCAAATCTAATGCTTCAACTTATCTGCCAACGG
TTGCGTTACTGGGGATGGGAAGCTCCGCAGGTGATGCGTTAACACAAAATCAATATACCACTCAGAACAA
TGTGAATGGTGGGGTGACATCAGCCTTAACCGGCAATGCGGGGCAGGCGGTACTGGGGCAGACGCTGGGA
GGGGGATTTAAAGAAGTTACCGACTGGGTTAAACAACGTTACGGACAGACGTTTGATGCGGTGTATGTCC
CACCTGGTGCAAATGTCGCTATTCATATTACTCGTCAACTGGCCGTTGATTATGAAGACCATGGTCGTAA
GGTTCGATATGACTTCAGCTTGCCCGGAACAGGAGGCCATTATGGTCTTGACTGA
 Primer design