SecReT4
Protein ID: 224586122
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4427
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4532850..4535687 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDC0Q5D3
KEGG IDsei:SPC_4427
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 3.6e-62, Aligned region: 54..318
AAA_10 [PF12846], Evalue: 1e-42, Aligned region: 512..859
Protein Sequence: 945 a.a.     [Download]
>gi|224586122|ref|YP_002639921.1| hypothetical protein SPC_4427 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MVSFSLFNKNRLKSSSPREPDELPESDFAVHGRDPLKRPGMMSHADESRLYETRPSIIDFLPWAEYLSRE
QCLLLDDGQSVGAVYSISPVASEGRTAARLEEIRDSVEDALQDSLEEFDSNPWVVQFFCQDETDFSAYMN
RLASYIKPHAQRTAFTKAWLAETEQHLRNITRPEGLFTDSLVTGVPWRGQNRSVRMVVYRYLPANYKDDS
PVAALNQVCERLTSALSAAGVLSVRQNGEQIHRWLLRHFNPEPDWIDKDTLYREARYYDDAPDSLPLGND
FTETLWFNPPRSDTRNGVWWFDNVAHRAVPVETLRRPPGPGHLTGEVKRGDNINTLMDLLPEGTMVSLTI
VAQAQDTLEAGFDTLGKNAIGQNTESRRTRSDVEQVKSLLGMRHKLYRASITFLMRAPDVSELNKKIQQL
TATLLTAGLQPTKPEYEVAPLNDYLRALPMCFNPQLDKKNWYTRLTWVQHLAGLLPVTGRSQGTGHPGFS
FFNRGGELLSFDPLNSLDRTQNAHLLLFGPTGAGKSATLCSALSQLMAVHRPRLFIAEAGNSFGLLAEYF
RGLGLSVNVLSIKPGCGISLPMFADAHSLMRVDPKKNVVSEEALPELEPANTDSAEDESEERDILGEMEI
AARMMITGGEKREEERLTRADRGLIREAIMMAAEKTYQDGHQMLAEDLQAALWNISRDNSIGANGEPMRN
QSRRDRAAEMAEAMAMFTQGFEGELFNRPGTPWPEADVTLIDLGHLAREGYGAQMALAMVSLINTINNIA
ERDQGTARDIVAVFDEAHISTTNPLLSPYMTKVVKMWRKLGAWLWLATQNLEDFPDIAQKMLNMAEWWLC
LVMPPDEVEQIARFKTLSEEQKVILRSASKLKNCYTEGVVLSKQVEALFRVVPPSLYLSLGMTEKEEKAE
RQRLMREYQCSELEAAIRVARRLDEARGFCPQKAA
 
Nucleotide Sequence: 2838 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4532850-4535687 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGGTCAGTTTTTCTTTGTTTAACAAAAACAGGCTGAAGTCATCTTCTCCCCGGGAGCCTGACGAGTTAC
CGGAAAGTGACTTTGCTGTTCATGGCCGTGACCCACTGAAACGCCCGGGCATGATGAGTCACGCTGATGA
ATCCCGTTTATACGAAACCCGTCCGTCCATTATTGATTTTTTGCCCTGGGCCGAGTACCTGAGTCGCGAG
CAATGTCTGCTGCTTGACGATGGCCAGTCTGTCGGTGCGGTATACAGTATATCGCCAGTGGCATCAGAGG
GGCGCACAGCTGCCCGTCTGGAAGAAATAAGGGATTCGGTTGAAGATGCACTTCAGGACAGCCTTGAAGA
GTTTGATTCTAACCCATGGGTAGTACAGTTTTTTTGTCAGGATGAAACTGACTTCAGTGCCTATATGAAT
CGGTTAGCCAGTTACATCAAACCGCATGCTCAGAGGACGGCATTTACGAAGGCCTGGCTGGCTGAAACAG
AACAGCATCTGCGAAATATCACCCGGCCGGAAGGTTTGTTCACTGATTCACTTGTCACCGGGGTTCCCTG
GCGGGGACAAAATCGTTCCGTCAGGATGGTGGTATATCGATACCTGCCAGCGAATTACAAAGATGATTCG
CCGGTTGCCGCTCTCAACCAGGTTTGTGAGCGCCTGACTTCAGCCTTATCTGCAGCCGGCGTTCTGAGTG
TCCGACAGAATGGCGAGCAGATACATCGATGGTTGTTACGTCACTTCAATCCTGAGCCCGACTGGATAGA
CAAAGATACGCTTTACCGGGAGGCTCGTTATTATGATGATGCACCTGATTCATTGCCTCTTGGCAATGAT
TTCACTGAGACGTTGTGGTTTAACCCTCCACGTTCTGATACCCGAAATGGTGTGTGGTGGTTTGATAATG
TGGCGCATCGTGCCGTTCCTGTTGAAACATTACGTCGCCCTCCGGGACCCGGTCATCTGACGGGGGAGGT
TAAGCGTGGCGACAATATTAATACTCTGATGGATTTATTGCCTGAGGGCACAATGGTATCGCTCACTATT
GTGGCGCAGGCTCAGGACACGCTGGAAGCCGGGTTTGACACGCTGGGTAAAAATGCAATAGGGCAGAACA
CGGAATCCAGGCGGACCCGTAGTGATGTGGAGCAGGTGAAGAGTTTGCTGGGCATGCGTCACAAACTTTA
TCGTGCATCGATAACTTTTTTGATGCGTGCACCTGATGTCAGTGAGCTGAATAAAAAAATACAGCAACTT
ACCGCTACATTGCTGACTGCGGGGCTCCAGCCCACGAAACCTGAATACGAAGTGGCGCCCCTGAATGACT
ATTTGCGAGCGCTTCCTATGTGTTTTAACCCGCAACTGGATAAAAAAAACTGGTATACCCGCCTGACCTG
GGTTCAGCATCTGGCTGGATTGCTTCCCGTGACCGGTCGCAGCCAGGGAACCGGACACCCCGGGTTTAGT
TTTTTTAACCGTGGCGGAGAACTGTTGTCTTTTGATCCCTTAAATAGTCTGGACAGAACGCAGAATGCTC
ACCTGTTGCTTTTTGGTCCGACCGGGGCGGGTAAATCAGCCACCTTATGTAGTGCGTTATCACAGTTAAT
GGCCGTTCATCGTCCACGCCTCTTTATTGCCGAAGCCGGCAACAGTTTTGGTTTGCTGGCGGAGTATTTC
CGGGGGCTGGGACTGAGCGTAAATGTACTGAGTATCAAACCTGGCTGCGGTATTTCTTTACCGATGTTTG
CTGATGCTCATTCCTTAATGCGAGTAGATCCAAAGAAAAACGTGGTTTCTGAGGAAGCTCTACCTGAGCT
GGAGCCAGCCAATACCGACAGCGCAGAAGATGAAAGTGAAGAGCGTGACATTCTTGGCGAAATGGAAATT
GCAGCCCGGATGATGATCACCGGTGGCGAGAAGCGGGAGGAGGAACGTCTTACCCGGGCTGACCGCGGTC
TTATTCGTGAAGCTATCATGATGGCGGCGGAGAAAACATATCAGGACGGACATCAGATGCTGGCTGAGGA
TTTACAGGCTGCCCTGTGGAATATCTCACGTGATAATTCCATTGGTGCAAATGGCGAGCCTATGCGGAAT
CAGTCCCGTCGCGATCGTGCTGCTGAGATGGCAGAAGCCATGGCCATGTTCACTCAGGGATTTGAGGGAG
AGTTATTCAACCGTCCGGGAACACCATGGCCAGAGGCTGATGTCACACTGATCGATTTAGGTCATCTGGC
ACGTGAAGGCTATGGTGCACAAATGGCGCTGGCGATGGTCTCTTTAATTAACACGATTAACAATATCGCC
GAACGTGACCAGGGAACAGCCCGGGATATTGTGGCCGTATTTGATGAAGCCCATATTTCCACGACGAATC
CTTTGTTGTCGCCCTATATGACCAAGGTTGTGAAAATGTGGCGAAAACTGGGGGCATGGCTGTGGCTGGC
GACACAGAACCTCGAGGATTTTCCTGATATTGCGCAGAAAATGCTGAACATGGCTGAATGGTGGTTGTGC
CTGGTTATGCCTCCCGATGAGGTGGAGCAGATTGCCCGTTTCAAAACCCTCAGCGAGGAGCAAAAAGTTA
TTTTGCGATCAGCCAGTAAGCTCAAAAACTGTTATACCGAGGGCGTCGTTTTATCAAAGCAGGTTGAGGC
ACTGTTCCGGGTTGTGCCTCCCAGTCTGTATCTCTCCCTGGGGATGACTGAAAAAGAGGAAAAAGCGGAA
CGTCAGCGGCTGATGCGAGAGTATCAGTGCAGTGAGCTTGAGGCAGCGATCCGGGTGGCCCGCAGGCTGG
ATGAGGCACGGGGTTTTTGTCCACAAAAAGCGGCCTGA
 Primer design