SecReT4
Protein ID: 224586123
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4428
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4535842..4536228 [+]
Producthypothetical protein
Component typeTfc17
UniProt IDC0Q5D4
KEGG IDsei:SPC_4428
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 128 a.a.     [Download]
>gi|224586123|ref|YP_002639922.1| hypothetical protein SPC_4428 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MSLLKHEQWLILGEDESHRIPPDALLGLPPQGKAWIRKEHDEDMSRLTSHIQGALGNTYRGVCHPQRIGH
RACLAIHLENLRGKKLDILITVSGKTALPAEESYVNPRWYIDVADAADALYLALWLIR
 
Nucleotide Sequence: 387 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4535842-4536228 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGAGCCTGTTAAAGCATGAGCAATGGTTAATTCTCGGTGAAGATGAATCGCATCGTATTCCGCCTGATG
CGCTGCTGGGTTTGCCTCCGCAGGGTAAAGCGTGGATCCGCAAGGAACATGATGAGGATATGAGTCGTCT
GACTTCTCATATTCAGGGAGCTCTTGGCAATACTTATCGTGGGGTTTGTCATCCACAGCGTATCGGGCAT
CGTGCCTGCCTGGCAATCCATCTTGAGAATTTACGCGGAAAAAAGCTGGATATATTAATTACGGTAAGCG
GAAAGACAGCATTACCTGCGGAGGAAAGTTACGTTAATCCCCGATGGTACATCGATGTTGCCGATGCCGC
AGATGCCCTTTATCTGGCGCTGTGGCTTATCAGGTAG
 Primer design