SecReT4
Protein ID: 224586124
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4429
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4536383..4536775 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDC0Q5D5
KEGG IDsei:SPC_4429
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 8.1e-39, Aligned region: 18..124
Protein Sequence: 130 a.a.     [Download]
>gi|224586124|ref|YP_002639923.1| hypothetical protein SPC_4429 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MKRILSSLILISSFSASAQIVVYTDQGHPPVGVTPAIRVVYLDASERWLQQQFGELSSDPEQAVRQAHSL
LNSPDWKRRQKALIEHYRGMIEAWQLGLLKYPAVVFDNRDVVYGTVDISRAVALRRGENQ
 
Nucleotide Sequence: 393 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4536383-4536775 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGAAACGAATCCTCTCTTCGCTGATATTAATCAGCTCCTTTTCTGCAAGTGCGCAAATCGTTGTTTACA
CCGACCAGGGGCATCCTCCGGTCGGTGTAACACCGGCTATCCGGGTTGTTTATCTCGATGCCAGCGAACG
CTGGCTGCAGCAACAATTTGGAGAGCTTTCTTCTGATCCTGAACAGGCTGTCAGACAGGCTCATTCTCTG
CTGAATTCTCCTGACTGGAAGAGACGGCAAAAAGCGCTTATCGAACATTACAGGGGAATGATTGAAGCAT
GGCAGCTTGGTTTACTGAAATATCCGGCGGTGGTTTTTGACAACCGTGACGTGGTTTACGGGACTGTTGA
TATATCCCGGGCAGTGGCGCTGCGCAGGGGAGAGAATCAATGA
 Primer design