SecReT4
Protein ID: 224586125
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4430
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4536772..4537740 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDC0Q5D6
KEGG IDsei:SPC_4430
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 7e-94, Aligned region: 30..310
Protein Sequence: 322 a.a.     [Download]
>gi|224586125|ref|YP_002639924.1| hypothetical protein SPC_4430 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MKSLRLKRALLSVMLITGGMEVQAALNTASIVASSISPSCISWRISGICYWLMCTPFGCTVKTSIKVHHF
IPEAVVSTYQASGGNPWTEMSLVSQTAGGVENAVTGALSGLAAGGGNQEQKFPGTRKSNVRFKYADAIGH
PSTSIIGGQIPGYSCNSAATPLVPYFLSTLDTLAWRTGVPESVYPEALIPGRREIGSTSAQNIWGNLYPR
SGFVTQQDDYKSGAIVAQRVADIITRTNQIHVYKPLTGNPSAGYWPPEPVKENTGTQNHKWQQLSPTLSM
SCSVFPDTGKIAENGNYAWTLWQPYSCCKRRGQTFLYSTDIN
 
Nucleotide Sequence: 969 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4536772-4537740 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGAAATCTCTTCGTCTGAAGCGAGCGTTACTGTCAGTCATGCTTATCACCGGCGGCATGGAGGTTCAGG
CTGCGTTGAACACTGCCTCGATTGTGGCCAGCAGTATTTCTCCGTCGTGTATCAGCTGGAGAATCAGCGG
TATCTGCTACTGGCTGATGTGTACCCCTTTCGGTTGTACAGTAAAAACCTCGATAAAAGTGCATCACTTT
ATTCCGGAAGCTGTTGTTTCGACTTATCAGGCGTCTGGTGGAAATCCGTGGACCGAAATGTCATTAGTGA
GTCAGACGGCCGGAGGGGTAGAGAATGCTGTAACGGGGGCGTTATCCGGGCTTGCTGCCGGTGGCGGAAA
CCAGGAACAGAAATTCCCGGGTACCCGTAAGAGTAATGTGCGATTTAAATATGCAGATGCCATTGGCCAT
CCTTCAACATCGATTATTGGCGGCCAAATCCCCGGTTACTCATGCAACAGCGCCGCCACACCACTGGTAC
CCTATTTTCTTAGCACGCTTGATACGCTTGCCTGGCGTACTGGTGTTCCTGAATCGGTTTATCCTGAGGC
ACTCATTCCTGGCAGACGCGAAATCGGCTCCACATCGGCACAAAATATATGGGGAAATCTCTATCCCCGA
AGCGGCTTTGTTACTCAGCAGGATGACTACAAATCCGGGGCAATCGTTGCGCAGCGTGTAGCTGACATTA
TCACCCGAACTAACCAGATCCACGTCTATAAGCCCCTCACCGGAAACCCGTCTGCCGGTTACTGGCCTCC
CGAACCTGTTAAAGAGAATACCGGCACGCAAAATCATAAATGGCAGCAGTTATCACCAACGCTCTCTATG
TCATGCAGCGTATTCCCGGATACAGGAAAAATTGCGGAAAACGGTAATTACGCCTGGACACTCTGGCAGC
CATATAGCTGCTGTAAACGCCGTGGGCAAACATTTCTCTATAGCACCGACATAAATTAA
 Primer design