SecReT4
Protein ID: 224586126
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4431
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4537788..4539185 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDC0Q5D7
KEGG IDsei:SPC_4431
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 465 a.a.     [Download]
>gi|224586126|ref|YP_002639925.1| hypothetical protein SPC_4431 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MLGIVSSGPLSAALLDAPTLSGDGYGKSVNGAVSDKLFYSIGGGSVISTPGTMYGMKRIGLDAGLSSDLM
CGNFDIKTTVGNQLNGVTNGFKDLMGDVITGATGAVSSMPAMILQRANPGLYEMITNGVLQAGLAFDKSK
LNCESMANKLADYTLGDKSSWTESAVREEYKEAVSASGGDALRAEEARTKASGKEGATWVGGKKAGGKGQ
PAIQPTRDLAKAGYNMMNNLSVTSNSTVSAGSCKGSACQKFKNSEEAAAAVVKVLGDRSIRTCKDATECG
SGGIDNAQGTTIAGTGFAPMLEDTTKENLEQLVKLVNGTEAPTQANLDKIKSGSLKVTRGVIDALKRDPD
AGALVQRLAGELAMSDTIETGLAMRRMLTTGQSEPNAADQPQAMAEADRRIEALDRELNSLKLEMELRRE
VAKNTALVVVAREENRSVTNPQKESQTNADTRLSELETRKPGDSQ
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4537788-4539185 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGCTGGGTATCGTCAGTTCGGGACCGTTAAGTGCTGCATTACTGGATGCCCCCACGTTGAGTGGTGATG
GATATGGAAAGTCAGTAAATGGCGCGGTTAGTGACAAGCTGTTTTACAGCATTGGTGGTGGTTCGGTGAT
TTCCACTCCCGGGACGATGTACGGAATGAAACGTATCGGGCTGGATGCCGGACTGAGCAGTGATTTGATG
TGTGGCAACTTTGATATAAAGACTACTGTCGGAAACCAGCTTAATGGCGTCACGAATGGTTTCAAAGATT
TGATGGGGGATGTGATCACCGGTGCGACCGGGGCGGTCTCAAGTATGCCGGCGATGATCCTTCAGCGAGC
AAATCCGGGTTTGTATGAAATGATCACCAATGGTGTACTTCAGGCAGGTCTGGCTTTTGACAAATCGAAA
CTGAATTGTGAAAGCATGGCCAACAAGCTGGCTGATTACACTTTGGGTGACAAGAGCAGCTGGACAGAAT
CAGCTGTGAGGGAAGAGTACAAGGAGGCGGTCAGTGCCAGTGGCGGGGATGCGCTGCGGGCAGAAGAGGC
CAGAACCAAAGCTTCAGGTAAGGAGGGCGCTACCTGGGTAGGCGGGAAGAAAGCCGGAGGGAAAGGCCAG
CCTGCCATTCAGCCAACGCGTGATCTGGCTAAAGCAGGATACAACATGATGAATAACCTGAGCGTTACCA
GCAACAGCACGGTATCCGCCGGTAGTTGCAAGGGGTCAGCATGCCAGAAATTTAAAAACTCTGAAGAAGC
TGCAGCAGCGGTCGTAAAAGTTCTGGGCGATCGGAGTATTCGCACCTGTAAAGATGCCACAGAATGCGGA
AGCGGCGGGATTGATAATGCCCAGGGCACGACAATTGCCGGTACCGGTTTTGCTCCCATGCTTGAGGATA
CAACCAAAGAGAATCTGGAACAGCTGGTAAAGCTTGTAAATGGTACTGAGGCTCCGACTCAGGCCAATCT
GGATAAAATTAAAAGTGGCAGCCTTAAGGTAACGCGTGGTGTCATCGATGCCCTGAAACGCGATCCTGAT
GCCGGTGCGTTGGTTCAGAGACTGGCTGGCGAACTGGCCATGTCCGACACGATTGAAACCGGTCTGGCGA
TGCGTCGCATGTTAACGACTGGCCAGTCTGAACCCAATGCAGCTGATCAGCCTCAGGCAATGGCTGAAGC
CGATCGCCGTATTGAAGCTCTCGATCGTGAGCTTAACTCTCTTAAGCTGGAGATGGAACTGCGTCGGGAA
GTGGCAAAAAATACCGCGCTGGTTGTGGTTGCGCGCGAAGAAAATCGTTCGGTCACCAATCCTCAAAAAG
AATCGCAGACTAATGCTGATACCCGGCTGAGTGAGCTTGAAACGCGTAAACCAGGGGACAGCCAATGA
 Primer design