SecReT4
Protein ID: 224586128
T4SS name [ID]Tfc [757]
Gene symbol-
Locus tagSPC_4433
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T4SS(s) in this replicon]
Location [Strand]4539518..4541023 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDC0Q5D9
KEGG IDsei:SPC_4433
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 9.6e-123, Aligned region: 8..484
Protein Sequence: 501 a.a.     [Download]
>gi|224586128|ref|YP_002639927.1| hypothetical protein SPC_4433 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MTTSSYLEYILTILGWVVNNGLWDVLTGTGLFALPLGFKIIGIWIKTREEGDDEGNKGILSARRMEHAIY
GAFIVIIACCVPTQTVSLTTLTFDTTRAKQCGFWTPVKPGDSGYGSVVSTMSGMTASAPVWWAFMHMISK
GVTQAAVASLPCRPDLRQVRFDVQHTQITNPALAQELQDFTSDCYAQAFALWKRQDAGRTTDIDVLRDIE
WLGSKIFLKDFYPQLHSKLPRSAFPWSQSRDDGYANTGQGGYPTCSEWWSQNKTGLKSRVLDTVNTTTMT
RMAAAFKGMVSKEEYTEALIRRLVSPTSLSVSQNGRTYAGYGGNADFTLDNAVNRMASVLGTSVGALGAF
PAFDAMRQALPMVQALLLMAMYVLIPLVLVFGTYEYKTVVTLTFVTFGMHFLTFWWELARWLDSWLLEIM
YGSDSHSRWNVAGFQNSADDLIMNFVMGTMFLVLPAVWMGALSWAGVRIGGIVDTNLNKGVQPAGQHGGK
VGDKIGSGIAK
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|224581838|ref|NC_012125.1|:4539518-4541023 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGACGACATCGAGCTATCTTGAGTACATCCTGACGATTCTGGGCTGGGTTGTTAATAACGGTTTGTGGG
ATGTTCTGACAGGCACGGGACTTTTTGCATTACCACTGGGCTTTAAAATCATTGGTATCTGGATCAAAAC
ACGGGAAGAAGGGGATGATGAGGGTAATAAAGGTATCCTGTCGGCCCGACGGATGGAACATGCTATTTAC
GGGGCATTTATCGTTATTATCGCCTGCTGTGTCCCCACTCAGACAGTGTCACTGACAACGCTGACGTTTG
ATACAACCCGTGCGAAACAGTGTGGTTTCTGGACACCGGTCAAGCCCGGGGATTCAGGCTACGGTAGTGT
GGTTTCAACAATGAGTGGTATGACTGCATCTGCGCCGGTGTGGTGGGCATTTATGCATATGATTTCCAAA
GGCGTCACTCAGGCGGCTGTGGCAAGTTTACCCTGCCGGCCAGACCTGCGGCAGGTGCGTTTTGACGTTC
AGCATACGCAGATCACCAATCCTGCTCTGGCTCAGGAATTGCAGGATTTTACCAGTGACTGTTATGCACA
GGCTTTTGCGTTATGGAAACGGCAGGATGCGGGGAGAACTACGGATATTGATGTACTCAGGGATATTGAA
TGGCTGGGGTCGAAAATATTTTTGAAGGATTTTTACCCGCAGCTGCATTCGAAGTTGCCCAGGTCAGCGT
TCCCCTGGTCGCAAAGCCGCGATGACGGGTACGCAAATACCGGGCAGGGGGGGTATCCAACGTGTAGCGA
GTGGTGGTCTCAGAACAAGACAGGCCTGAAATCCCGTGTGCTGGATACGGTAAATACCACCACGATGACA
CGCATGGCGGCAGCATTTAAGGGAATGGTCAGCAAAGAGGAATACACGGAAGCGCTAATTCGACGTCTGG
TCAGTCCGACAAGTCTCTCTGTGTCACAGAATGGACGTACTTATGCAGGTTATGGCGGTAATGCCGATTT
TACGTTAGATAATGCTGTAAATCGCATGGCTTCAGTGCTGGGGACCAGTGTGGGTGCCCTTGGGGCGTTC
CCCGCATTTGATGCCATGCGCCAGGCGTTACCGATGGTTCAGGCACTTTTATTGATGGCCATGTATGTAC
TAATCCCCCTGGTGCTGGTATTCGGGACGTATGAATATAAGACAGTAGTCACTCTCACTTTTGTGACGTT
TGGGATGCATTTTCTTACGTTCTGGTGGGAGCTGGCGCGCTGGCTGGATAGCTGGCTTCTGGAGATCATG
TATGGTTCGGACAGCCATAGCCGATGGAATGTGGCCGGTTTTCAGAATAGCGCAGATGACCTGATCATGA
ACTTTGTTATGGGGACGATGTTCCTGGTGTTGCCGGCAGTGTGGATGGGGGCGCTTTCCTGGGCTGGGGT
TAGAATTGGCGGCATTGTTGACACTAACTTAAATAAGGGAGTGCAGCCAGCTGGACAGCATGGTGGCAAA
GTTGGTGATAAAATTGGCTCGGGAATAGCTAAATAA
 Primer design