SecReT4
Protein ID: 225629876
T4SS name [ID]VirB [481]
Gene symbol-
Locus tagWRi_000050
StrainWolbachia sp. wRi
Repliconchromosome [GenBank: NC_012416] [Browse all T4SS(s) in this replicon]
Location [Strand]4300..4980 [+]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDC0R534
KEGG IDwri:WRi_000050
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.2e-54, Aligned region: 19..224
Protein Sequence: 226 a.a.     [Download]
>gi|225629876|ref|YP_002726667.1| type IV secretion system protein VirB8 [Wolbachia sp. wRi]
MLRFFKREKSTESLDKDINWNSNRYSTVIAQRNILLLFALILLATISISILVIFKISTSSTIEPFVIEID
KKSGIVQLVDPVTVKQYSADEALNDYFISEYIKAREVFDPYHYNYNYYTKVRLFSSPNVYNEFRNYIGSQ
NMDDLFNLYSDTKNEFKIRSIQKLGNDALQVRFFVEFIRKDGSSTRKNKIVIMSYRYASLEMNDQQRYIN
PLGFQVISYRVDDEYV
 
Nucleotide Sequence: 681 bp     [Download]
>gi|225629872|ref|NC_012416.1|:4300-4980 Wolbachia sp. wRi, complete genome
ATGCTAAGATTTTTTAAGCGAGAGAAAAGTACTGAATCGTTAGATAAGGATATAAATTGGAATTCAAACC
GCTACAGCACAGTTATTGCTCAAAGGAATATTCTACTTTTATTTGCGTTAATATTATTAGCAACGATCTC
TATCAGCATATTAGTCATATTTAAAATTAGCACAAGTAGCACTATTGAGCCATTTGTTATAGAAATTGAC
AAGAAATCGGGAATAGTGCAATTGGTTGATCCTGTCACAGTAAAGCAGTATTCTGCAGATGAAGCGCTGA
ACGATTATTTTATTTCAGAGTATATAAAAGCAAGGGAGGTTTTTGATCCATATCATTATAATTATAACTA
TTATACAAAGGTGAGGTTGTTTTCCTCACCTAATGTGTATAATGAATTTAGAAATTATATAGGATCGCAG
AATATGGATGATCTTTTTAATTTATATTCAGATACCAAAAATGAATTTAAAATTCGCTCGATTCAAAAAT
TGGGTAACGATGCTCTTCAGGTGAGGTTTTTTGTGGAATTTATACGGAAAGATGGAAGTTCCACAAGAAA
AAATAAGATAGTTATTATGTCATATAGATATGCATCGCTTGAAATGAATGATCAGCAAAGATATATTAAC
CCATTAGGGTTTCAAGTTATTTCATATAGAGTAGATGATGAATATGTATAG
 Primer design