SecReT4
Protein ID: 225629879
T4SS name [ID]VirB [481]
Gene symbol-
Locus tagWRi_000080
StrainWolbachia sp. wRi
Repliconchromosome [GenBank: NC_012416] [Browse all T4SS(s) in this replicon]
Location [Strand]7282..8274 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDC0R537
KEGG IDwri:WRi_000080
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.6e-88, Aligned region: 11..310
Protein Sequence: 330 a.a.     [Download]
>gi|225629879|ref|YP_002726670.1| type IV secretion system protein VirB11 [Wolbachia sp. wRi]
MNYAALDTYLEPLQGIFQEEGVNEISINKPKEVWIENRGEIRCEKLEIFDLNHLKSLGRLIAQATEQKLS
EEAPLLSATLPNGYRIQIVFPPACEPDKVVMSIRKPSSMQLALDDYEKMGAFSETVTEATDNPVDRHLDL
LLRQKKIKEFLEYAVISKKNIIISGGTSTGKTTFTNATLRAIPAEERIITVEDAREIVLNDHPNKVHLIA
SKGGQGRAKVTTQDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADSPTMALEQIKLM
VMQANLGIPPDQIIPYIKNVIDIVIQLKRTGGGKRSISEILFTRSASENA
 
Nucleotide Sequence: 993 bp     [Download]
>gi|225629872|ref|NC_012416.1|:7282-8274 Wolbachia sp. wRi, complete genome
ATGAACTATGCTGCACTTGATACATATTTGGAGCCATTACAAGGCATATTTCAAGAAGAAGGCGTAAATG
AAATATCAATAAATAAGCCAAAGGAAGTATGGATTGAAAATCGTGGTGAAATAAGGTGTGAAAAATTAGA
AATATTCGATCTTAACCATTTGAAATCTCTTGGCAGACTGATTGCTCAAGCTACAGAACAAAAACTTAGC
GAAGAAGCACCTTTACTTTCGGCAACATTACCAAATGGTTATCGTATACAGATAGTATTTCCGCCAGCAT
GTGAGCCTGATAAAGTAGTCATGTCGATTCGTAAGCCTTCTAGCATGCAGTTAGCACTCGATGATTACGA
AAAAATGGGGGCTTTTTCTGAAACTGTTACAGAAGCAACTGATAATCCAGTTGACCGTCATTTGGATTTA
TTGTTAAGGCAAAAAAAAATAAAAGAGTTTTTAGAATACGCTGTAATAAGTAAGAAAAATATTATAATTA
GTGGTGGAACTTCCACTGGTAAGACTACTTTTACTAATGCTACTTTGCGTGCTATTCCAGCTGAGGAAAG
AATTATTACTGTTGAGGATGCAAGGGAAATCGTTTTGAACGATCATCCCAATAAAGTCCATCTAATTGCC
TCTAAAGGAGGGCAGGGCAGAGCAAAAGTAACCACTCAAGATTTGATAGAAGCGTGCTTACGTTTAAGGC
CAGACAGAATAATAGTTGGTGAGCTCCGTGGAGCGGAAGCTTTTAGTTTTCTCAGGGCGATAAATACTGG
TCACCCTGGATCAATATCAACCCTTCATGCAGATAGTCCAACAATGGCCCTTGAGCAAATAAAATTGATG
GTTATGCAGGCAAATCTTGGCATTCCTCCAGACCAAATTATACCATACATTAAAAATGTGATTGATATTG
TTATTCAGCTAAAAAGAACCGGTGGGGGCAAAAGAAGCATTTCTGAGATATTATTTACTAGATCTGCGAG
CGAAAATGCTTAA
 Primer design