SecReT4
Protein ID: 225629880
T4SS name [ID]VirB [481]
Gene symbolvirD4
Locus tagWRi_000090
StrainWolbachia sp. wRi
Repliconchromosome [GenBank: NC_012416] [Browse all T4SS(s) in this replicon]
Location [Strand]8305..10323 [+]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDC0R538
KEGG IDwri:WRi_000090
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 8.2e-152, Aligned region: 123..566
TraG-D_C [PF12696], Evalue: 2.1e-26, Aligned region: 406..528
TrwB_AAD_bind [PF10412], Evalue: 9.5e-26, Aligned region: 239..542
AAA_10 [PF12846], Evalue: 3e-05, Aligned region: 377..482
Protein Sequence: 672 a.a.     [Download]
>gi|225629880|ref|YP_002726671.1| type IV secretion system protein VirD4 [Wolbachia sp. wRi]
MSNGNHLRNILIGGVVAFSVLEFCFYLSGILFVLFADGPDAVDFKAINPSLTPFPQALWPTIFDHIQYCW
HHPELYSLELKITLIISSALPIIVLMIILWNLRERIIEWRPFKKKESLHGDSQWASEKDIRKAGLRSKKG
LLLGKDKRGYFISDGFQHALLFAPTGSGKGVGFVIPNLLFWTDSVIVHDIKLENYEITSGWRERQGQKVY
VWNPAQPDGISHCYNPLQWISEKPGQMVDDVQKIANLIMPEQDFWQNEARSLFVGVVLYLLAAPEKVKSF
GEVVRTMRSDDVVYNLAVALDTMGKILHPVAYMNIAAFLQKADKERSGVVSTMNSSLELWANPLIDTATA
SSDFNILDFKKKKTTVYVGLTPDNLTRLRPLMQVFYQQATEFLCRKLPSDDEPYGVLFLMDEFPTLGKME
QFQTGIAYFRGYRVRLFLIVQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLIGNKTVQQ
ESLNKPKFLDLNPASRSLHISEIQRALLLPQEVIMLPRDDQIILIESTYPIKSKKILYYSDSTFTKRLLK
QTRVPTQEPYDPNKVLSAAASKDKVNNEGNNALEGPNSVDYPAETKTEDAVYDESNEFADEDIDDEDIDD
KFEDDDDGFDDEEKSDDGFDDEEEEDEFEDEDIDDKFKNDEK
 
Nucleotide Sequence: 2019 bp     [Download]
>gi|225629872|ref|NC_012416.1|:8305-10323 Wolbachia sp. wRi, complete genome
ATGAGTAATGGAAATCACCTACGTAATATTCTCATAGGAGGTGTAGTAGCTTTTAGCGTACTTGAGTTTT
GCTTCTATCTATCTGGTATATTGTTTGTTCTGTTTGCTGATGGTCCGGATGCTGTGGATTTTAAGGCAAT
TAATCCTAGTTTGACGCCTTTCCCTCAAGCTCTTTGGCCAACGATTTTTGATCATATACAATATTGTTGG
CATCATCCAGAGTTATATAGCCTTGAGCTCAAAATCACATTAATTATATCTTCTGCACTGCCTATCATTG
TTTTAATGATTATCTTATGGAATTTAAGAGAAAGGATAATTGAGTGGCGACCATTTAAAAAGAAGGAATC
ACTTCATGGAGATTCGCAGTGGGCATCAGAGAAAGACATACGAAAAGCAGGATTAAGAAGCAAAAAGGGA
TTATTGCTTGGTAAAGATAAAAGAGGATACTTCATTTCTGATGGGTTTCAGCATGCATTGTTATTTGCAC
CTACAGGTTCTGGTAAGGGTGTTGGCTTTGTAATTCCTAATTTATTATTTTGGACTGACTCGGTAATTGT
ACACGACATAAAATTAGAAAACTATGAAATAACAAGTGGTTGGCGAGAACGACAAGGACAAAAAGTATAC
GTATGGAATCCAGCGCAGCCAGATGGAATAAGTCACTGTTACAATCCATTACAATGGATTAGTGAAAAAC
CTGGACAGATGGTTGACGATGTGCAGAAAATAGCCAACCTAATTATGCCTGAACAAGACTTTTGGCAAAA
TGAAGCAAGAAGTTTATTTGTTGGAGTGGTATTATACTTACTTGCTGCACCAGAGAAAGTCAAATCTTTT
GGTGAAGTTGTGCGTACGATGCGTAGTGATGATGTAGTCTATAATCTTGCTGTTGCTCTTGATACAATGG
GTAAAATACTACACCCTGTAGCATATATGAACATTGCAGCTTTTTTACAAAAAGCTGATAAAGAAAGGTC
GGGTGTTGTATCAACCATGAACTCATCACTTGAATTGTGGGCAAACCCATTGATTGATACTGCAACTGCG
TCAAGTGATTTTAATATTTTAGATTTTAAAAAGAAGAAAACTACAGTTTATGTTGGTTTAACTCCTGACA
ACTTGACTAGGCTCAGGCCTTTAATGCAGGTTTTTTACCAACAGGCAACTGAGTTTTTATGTAGAAAATT
GCCATCAGATGACGAGCCTTATGGCGTATTGTTTTTAATGGATGAGTTTCCTACACTTGGAAAAATGGAG
CAATTTCAAACAGGTATTGCATATTTTCGTGGTTATCGAGTTAGGTTATTCTTAATTGTTCAAGATACTG
AGCAGCTCAAAGGAATATACGAAGAAGCAGGGATGAACTCCTTTTTGTCAAACTCGACTTACAGAATAAC
TTTTGCAGCCAATAATATTGAAACAGCTAATTTAATATCGCAACTTATAGGAAATAAAACTGTACAACAA
GAATCGTTAAACAAACCTAAGTTTTTAGACTTGAATCCTGCTTCAAGGTCGTTACATATCTCTGAAATAC
AGAGAGCATTGCTATTGCCTCAAGAAGTTATTATGTTGCCACGCGACGATCAGATAATTTTAATAGAGTC
GACTTACCCAATTAAATCAAAGAAAATTTTGTACTATAGTGATAGCACCTTCACAAAAAGACTGCTCAAG
CAAACTCGTGTGCCTACACAAGAACCATATGACCCAAACAAAGTTCTTTCTGCCGCTGCGAGCAAAGATA
AGGTTAATAATGAGGGGAATAATGCTCTTGAGGGACCTAATTCAGTTGATTATCCTGCTGAAACTAAAAC
AGAAGATGCAGTATATGATGAATCAAATGAATTTGCAGACGAAGATATTGATGATGAAGATATCGACGAT
AAGTTTGAAGATGATGATGACGGGTTTGATGATGAGGAAAAGAGCGATGATGGGTTTGATGACGAAGAAG
AGGAGGATGAATTTGAAGATGAGGATATTGATGATAAATTCAAAAATGACGAGAAGTAA
 Primer design