SecReT4
Protein ID: 225685344
T4SS name [ID]Tra_F [803]
Gene symbol-
Locus tagPERMA_A0024
StrainPersephonella marina EX-H1
Repliconplasmid unnamed [GenBank: NC_012439] [Browse all T4SS(s) in this replicon]
Location [Strand]16974..17585 [-]
Producthypothetical protein
Component typeTraW_F
UniProt IDC0QUV3
KEGG IDpmx:PERMA_A0024
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 203 a.a.     [Download]
>gi|225685344|ref|YP_002729752.1| hypothetical protein PERMA_A0024 [Persephonella marina EX-H1]
MRKIISIFLSLGLIGFGYSLENLGTFGKVYQIEEEDIIEYIKKNAKPPKFSREYIQRKIHAAAQVDVNLP
VNKRDNVRYEKIIYTVPNDIIIEGKLIAKKGTKINVLKEIKLHNTYVILADYMLPYFLDWNKKTNAVYLI
TQGNILDLQKKYPDLRIYAGFPKVLSSLKVKSIPSIVYQYQDKLVILEKGFPNDKKSVDDTNK
 
Nucleotide Sequence: 612 bp     [Download]
>gi|225685337|ref|NC_012439.1|:c17585-16974 Persephonella marina EX-H1 plasmid unnamed, complete sequence
ATGAGGAAGATAATATCTATATTTTTATCACTGGGCTTAATAGGTTTTGGCTATTCACTGGAAAATTTGG
GAACTTTCGGAAAGGTCTATCAAATTGAAGAGGAAGACATTATTGAATACATAAAGAAAAATGCCAAACC
ACCTAAATTCTCCAGAGAATATATCCAGCGAAAAATACATGCAGCTGCACAGGTAGATGTCAATCTACCT
GTTAACAAAAGAGATAATGTTAGATATGAAAAGATAATATACACAGTTCCTAACGACATAATAATAGAAG
GAAAACTCATAGCGAAAAAAGGAACAAAAATAAATGTTTTGAAAGAAATTAAACTGCATAACACCTATGT
AATCCTTGCAGACTATATGCTTCCTTATTTTTTAGATTGGAATAAAAAAACCAATGCTGTTTATCTGATA
ACTCAAGGAAATATTCTTGATTTGCAAAAGAAATATCCAGACTTAAGGATTTATGCTGGTTTTCCTAAAG
TGCTTTCAAGTTTAAAGGTTAAGTCCATACCTTCTATTGTTTATCAGTATCAGGACAAGCTTGTAATTTT
GGAAAAGGGGTTTCCAAATGATAAGAAAAGTGTTGATGACACTAATAAGTAG
 Primer design