SecReT4
Protein ID: 225685355
T4SS name [ID]Tra_F [803]
Gene symbol-
Locus tagPERMA_A0042
StrainPersephonella marina EX-H1
Repliconplasmid unnamed [GenBank: NC_012439] [Browse all T4SS(s) in this replicon]
Location [Strand]32848..34098 [-]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDC0QUX1
KEGG IDpmx:PERMA_A0042
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5e-36, Aligned region: 210..398
IncA [PF04156], Evalue: 9e-05, Aligned region: 34..130
Protein Sequence: 416 a.a.     [Download]
>gi|225685355|ref|YP_002729770.1| TraB pilus assembly family protein [Persephonella marina EX-H1]
MEEKKNSQNVEEKEEIKEEVETIEDRLNKKRMVILGAITAGISLFVIFSFFSNVIFGLADNTSVPQYQPK
KEGEKTIAPKVEEDWKAITEMKINQLQERLQRMEDTNKQILQLLQEQKQEREMLREEIEREIEERVKTTP
SASVPPPPPQTPVQYGQPQGQQGQQGQQQKAPALKEFKPDKEEETDKKEVSKTEKKEKKAVKIKLPLGFL
KGLTLTGLDAPTFQYGQNNPHPVLIVSLSKQIIANNKKLNLKECFFLGSGFGEISSERAYIRLVKLSCID
KKGNVLEQKVAGWVLDDDGKVGLRGRVVSKQGAVLAKTFMAGLLEGLSRTIAATSTTIQISPVGTTQTLN
PQDATKVALASGFQSAASRLAQFYMKIAEQMYPVVEVSPGRKITILISGGSLEKTKDNKLISNPLK
 
Nucleotide Sequence: 1251 bp     [Download]
>gi|225685337|ref|NC_012439.1|:c34098-32848 Persephonella marina EX-H1 plasmid unnamed, complete sequence
ATGGAAGAGAAGAAAAATAGTCAAAATGTAGAAGAAAAGGAAGAAATAAAAGAAGAAGTTGAGACAATAG
AGGACAGGCTAAATAAAAAAAGAATGGTTATTCTGGGGGCGATTACTGCTGGAATATCTCTATTTGTAAT
ATTCTCTTTCTTTTCAAATGTTATATTTGGGCTTGCTGACAATACATCAGTTCCCCAGTATCAGCCAAAG
AAGGAGGGAGAAAAAACCATAGCACCGAAAGTTGAGGAAGACTGGAAAGCGATTACGGAAATGAAAATAA
ATCAGCTTCAGGAAAGACTGCAAAGAATGGAAGATACAAACAAGCAAATTCTCCAGCTACTCCAAGAACA
AAAACAGGAAAGAGAAATGCTCCGTGAGGAAATAGAAAGGGAAATAGAGGAAAGAGTTAAAACCACTCCA
TCTGCTTCAGTTCCACCACCACCACCACAAACACCAGTTCAGTATGGTCAACCGCAAGGGCAACAGGGAC
AACAGGGACAACAACAAAAAGCACCAGCTTTAAAGGAATTTAAACCAGACAAAGAGGAAGAAACAGATAA
AAAAGAAGTTAGCAAAACAGAAAAGAAAGAAAAGAAAGCCGTTAAAATAAAACTTCCACTTGGATTTTTA
AAAGGTCTTACATTAACAGGTCTTGATGCTCCAACATTCCAGTATGGACAGAATAATCCACATCCAGTTT
TGATAGTATCTCTTTCAAAGCAGATAATAGCAAACAATAAAAAATTAAATCTAAAAGAATGTTTCTTTTT
AGGTTCTGGTTTCGGAGAAATCTCAAGTGAAAGGGCTTATATCAGGCTTGTAAAGTTATCCTGTATAGAT
AAGAAAGGAAATGTTTTAGAGCAAAAGGTTGCTGGATGGGTTCTTGATGATGACGGAAAAGTAGGCTTGA
GAGGCAGAGTTGTAAGTAAGCAGGGAGCTGTTTTAGCTAAAACATTTATGGCAGGGCTTCTTGAAGGTTT
ATCCAGAACTATAGCCGCTACATCAACAACAATACAAATATCTCCAGTAGGGACCACGCAAACTCTAAAT
CCGCAGGATGCAACAAAGGTTGCACTTGCAAGTGGTTTTCAGAGTGCAGCTTCAAGACTTGCACAGTTCT
ACATGAAAATCGCAGAGCAGATGTATCCAGTAGTTGAAGTATCTCCCGGTAGAAAGATAACAATACTTAT
ATCTGGGGGAAGCCTTGAGAAAACTAAAGATAATAAGCTTATTAGCAATCCTCTTAAGTAG
 Primer design