SecReT4
Protein ID: 225685356
T4SS name [ID]Tra_F [803]
Gene symbol-
Locus tagPERMA_A0019
StrainPersephonella marina EX-H1
Repliconplasmid unnamed [GenBank: NC_012439] [Browse all T4SS(s) in this replicon]
Location [Strand]11386..13944 [-]
Producthypothetical protein
Component typeTraN_F
UniProt IDC0QUU8
KEGG IDpmx:PERMA_A0019
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 852 a.a.     [Download]
>gi|225685356|ref|YP_002729747.1| hypothetical protein PERMA_A0019 [Persephonella marina EX-H1]
MHRSKSVIILQLIAFISFSFAAVITESTKTTCPADPTFGGKCHLKEVRNDGPSCKTINGVEVCRNWWKKE
YVYECEGQDNSALFSTFENQSYCRLVSRCKTWEDVSLKGGNVSCRIYIDKNRPGCETNPNRAECVADDCG
DIKNKCTFLEYIPFGNIPDKANTTSQYTCDAYGTTCGYVQVPTSSGINLGTYVYECPSDVRKVCREYEQV
LKCPAECPDGTKVDCPDNSNQATCPDGSIATCKTETCNTTKTCIQYETVNVQGTEIKTCLAPRSYTEYKV
EAGSQQAQDLANNPSCIKVSDDITPCPYSTRTYGNTTICELAGRHSNIGGSSGQVFIGRNIQVPDGTDLV
VYIYTGNSCDDDNTRVDAFIKDSRTGQIIGEKHTSCSINGQVFTLYRNTRNLTIDYKLKIVHCIGSGCGS
NDYNFSDTETSTSWNYGGSTWDSHDSSLGWKVYHWETYRCYTDTIDTSSCSSFSSNCTLQDNLNDLSSLA
CNKFAIDINNSNKNVCSEFAIQYECPATITKQQCVKYETKSVCNGVSYPVRSVEVENKDFSNEFNKAMAL
AQLANELKHVWAGKYMRCDSGWFSSVFENPMDYFKQKMVSFIVMQLGAQFLSAATTFVQDYLGSCLSPAV
AGVDFATTGDATAVSQESVADCMGSAAGQAWADAGDNSMMQSMLEKMGLNSGAASFLASPYGQLAISVAI
DIFTQTNKCNACTSKSCAEAHGFYNTYGLIKGGNCHYVESGCAWKVKYGIGSVCLRKKYMYCCYDSVFAR
ILVEQAYKQLGYSFAGGNCSALTFDDIKNLDFSSMDFTELQNYLEAKMKGQIDPNLIKNKINSYFDSDYG
TQTFTGETPYSN
 
Nucleotide Sequence: 2559 bp     [Download]
>gi|225685337|ref|NC_012439.1|:c13944-11386 Persephonella marina EX-H1 plasmid unnamed, complete sequence
ATGCACAGAAGTAAATCAGTAATAATACTGCAATTAATTGCTTTTATAAGTTTTTCATTTGCAGCTGTAA
TAACCGAAAGCACTAAAACAACCTGTCCAGCAGACCCTACATTCGGGGGAAAATGCCATTTAAAAGAAGT
AAGAAATGACGGACCATCCTGTAAAACAATAAATGGTGTTGAAGTTTGTAGGAACTGGTGGAAGAAAGAA
TATGTATATGAATGCGAAGGACAGGATAACTCAGCTTTATTCAGCACATTTGAAAATCAAAGTTATTGCA
GACTTGTTAGTAGATGTAAAACTTGGGAAGATGTGAGCCTAAAAGGTGGAAATGTATCTTGTAGAATATA
CATAGATAAAAATAGACCGGGATGTGAAACCAATCCCAATAGAGCTGAATGTGTAGCAGATGACTGCGGG
GATATAAAAAACAAATGCACCTTTCTTGAATACATACCTTTTGGAAATATTCCTGATAAAGCTAACACAA
CAAGTCAATATACCTGTGATGCCTATGGAACTACATGTGGTTATGTCCAAGTGCCAACTTCAAGTGGAAT
AAATCTTGGAACTTATGTTTATGAGTGTCCCTCAGATGTTAGGAAAGTTTGTAGAGAATATGAACAGGTA
TTAAAATGTCCAGCTGAATGTCCAGATGGAACTAAAGTTGATTGTCCCGATAATTCAAACCAAGCAACCT
GTCCAGATGGAAGCATAGCAACATGCAAAACTGAAACATGCAATACTACAAAAACTTGCATTCAATACGA
AACTGTAAATGTTCAAGGGACAGAAATAAAAACTTGCCTCGCTCCAAGAAGCTATACAGAATATAAGGTT
GAAGCAGGTAGTCAACAAGCTCAAGATTTAGCTAACAACCCAAGCTGTATAAAAGTATCAGATGACATAA
CTCCTTGTCCTTACTCAACAAGAACCTATGGGAATACTACTATATGTGAACTTGCAGGTAGGCATAGTAA
TATAGGTGGTAGTTCAGGACAAGTATTCATTGGAAGAAATATTCAAGTTCCTGATGGGACTGATTTGGTT
GTTTATATATATACAGGAAACTCTTGTGATGATGACAATACAAGAGTAGATGCTTTCATTAAAGATAGCA
GAACAGGGCAAATAATCGGTGAAAAACATACAAGCTGTTCTATAAATGGACAAGTCTTTACTCTATACAG
AAATACACGAAACTTAACTATTGATTACAAGCTCAAGATAGTCCACTGTATAGGTTCTGGTTGCGGAAGC
AATGACTATAACTTTTCAGATACAGAAACATCAACAAGCTGGAATTATGGGGGTTCTACTTGGGATAGCC
ACGACAGCAGTTTAGGCTGGAAGGTGTATCACTGGGAAACTTACAGATGTTATACAGATACAATTGACAC
TTCAAGCTGTTCATCCTTTAGTAGTAATTGCACACTTCAAGATAATCTCAATGACCTATCATCTTTAGCC
TGTAATAAATTTGCGATAGACATAAATAACTCAAATAAAAATGTATGTTCAGAGTTTGCCATTCAGTATG
AATGTCCAGCAACCATAACTAAACAGCAATGTGTAAAGTATGAAACTAAATCTGTTTGTAATGGAGTATC
GTATCCTGTAAGAAGTGTAGAGGTTGAAAACAAAGACTTTTCAAATGAGTTTAACAAAGCTATGGCTTTA
GCACAATTAGCCAATGAGTTAAAACATGTATGGGCTGGAAAATATATGAGATGTGATAGCGGATGGTTTA
GTTCGGTCTTTGAAAACCCTATGGACTATTTCAAGCAAAAAATGGTTTCTTTCATTGTTATGCAATTAGG
GGCTCAATTCCTGTCAGCCGCAACAACTTTTGTTCAGGACTATTTAGGTTCTTGTCTCTCTCCTGCCGTT
GCTGGAGTTGATTTTGCTACTACTGGAGATGCAACAGCAGTATCACAGGAAAGCGTAGCTGACTGCATGG
GAAGTGCCGCTGGGCAGGCTTGGGCTGATGCTGGAGACAACAGTATGATGCAATCAATGCTTGAGAAAAT
GGGACTAAATAGTGGTGCAGCTTCATTCTTAGCAAGTCCTTACGGTCAGCTTGCTATATCTGTTGCAATA
GATATTTTTACACAAACAAACAAATGTAATGCCTGCACATCAAAAAGTTGTGCAGAAGCACATGGGTTCT
ATAACACTTATGGATTAATCAAAGGTGGAAACTGTCATTATGTAGAAAGTGGCTGTGCTTGGAAGGTTAA
ATACGGCATAGGTTCTGTATGCTTAAGAAAGAAATACATGTATTGTTGTTATGATAGTGTATTTGCCAGA
ATACTTGTAGAGCAGGCATATAAACAGCTTGGGTATTCCTTTGCAGGCGGTAATTGTTCAGCATTGACTT
TTGATGATATAAAAAACCTTGACTTTTCATCTATGGACTTTACTGAACTACAAAACTATCTTGAAGCAAA
AATGAAGGGGCAGATAGACCCCAACTTAATCAAAAATAAGATAAACAGCTACTTTGATAGCGATTATGGA
ACTCAAACCTTTACTGGAGAAACTCCATATAGTAATTAG
 Primer design