SecReT4
Protein ID: 225685369
T4SS name [ID]Tra_F [803]
Gene symboltraL
Locus tagPERMA_A0046
StrainPersephonella marina EX-H1
Repliconplasmid unnamed [GenBank: NC_012439] [Browse all T4SS(s) in this replicon]
Location [Strand]35844..36140 [-]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDC0QUX5
KEGG IDpmx:PERMA_A0046
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.5e-08, Aligned region: 11..84
Protein Sequence: 98 a.a.     [Download]
>gi|225685369|ref|YP_002729774.1| type IV conjugative transfer system protein TraL [Persephonella marina EX-H1]
MEGKAEGRKVYPIPKYIDDLPEVVFIPIDIFLISATAFMIAFVSFNPFIGAIVGPATGFAYYHFRKGKPR
NFLHLIFYKTGLASVKGAVPPTEKEIKA
 
Nucleotide Sequence: 297 bp     [Download]
>gi|225685337|ref|NC_012439.1|:c36140-35844 Persephonella marina EX-H1 plasmid unnamed, complete sequence
ATGGAAGGCAAAGCAGAAGGAAGAAAAGTATATCCAATACCAAAATATATTGACGACCTTCCCGAGGTCG
TCTTTATCCCAATAGATATATTTCTCATATCGGCAACCGCCTTTATGATTGCCTTTGTCTCTTTTAATCC
TTTCATTGGGGCAATTGTAGGACCTGCAACAGGATTTGCTTATTATCACTTCAGGAAAGGAAAACCAAGA
AACTTTCTACATCTAATTTTCTATAAAACAGGTCTTGCTTCTGTAAAAGGTGCAGTCCCGCCGACAGAAA
AAGAAATAAAGGCATAA
 Primer design