SecReT4
Protein ID: 225685378
T4SS name [ID]Tra_F [803]
Gene symbol-
Locus tagPERMA_A0032
StrainPersephonella marina EX-H1
Repliconplasmid unnamed [GenBank: NC_012439] [Browse all T4SS(s) in this replicon]
Location [Strand]23761..25164 [-]
Producthypothetical protein
Component typeTraH_F
UniProt IDC0QUW1
KEGG IDpmx:PERMA_A0032
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.6e-23, Aligned region: 25..386
Protein Sequence: 467 a.a.     [Download]
>gi|225685378|ref|YP_002729760.1| hypothetical protein PERMA_A0032 [Persephonella marina EX-H1]
MKKLIASLAFASLLIAPTKADINATLDKIVGSSYYLPPGEIKSPTTNTYTLGSYSFRLRNDLLNRPVLSL
RPPQATFSCSGADFDAGMLSMLNLNTFGDMLSQAGTSVAWGIMIGLVYSLPGIGDAFQKLNEWARMFQQL
ISNSCMIGTQIGKNLGSSIWESGRTNAQGKGVASGSVSSFEAAQKEFIDLIKTTGEIKKFFGTIPYGPLY
EGGWTDTETADLVASLFGVLEWRAVDTAGNDCTDTSCLKNAKIKVVYYPPLTNNLQDIINGATMQIYHCN
WGYDTNIGTFKCNGGVEVSNKDIPEGLRQKIVNRIDGIVDDIIDGTFMANPDDAQWIKSVPLPNFPEVIN
YLAILKKQGFTSQYNSALYGVSELISSMMLKVLIDNAYASLSSIGRYFTNKDMPKDLAGAQQNITKVKAQ
IDDYIQKNIQSNYITIQVASQTYRSIKSAVEKGFVDKFGQTAYLFMR
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|225685337|ref|NC_012439.1|:c25164-23761 Persephonella marina EX-H1 plasmid unnamed, complete sequence
ATGAAAAAACTGATAGCTTCTTTAGCTTTTGCTTCTTTATTAATAGCACCCACAAAGGCGGATATAAATG
CAACTTTAGATAAGATTGTAGGCAGTTCCTATTATCTACCACCGGGAGAGATAAAGTCCCCTACTACTAA
CACATATACACTTGGTTCATATTCATTTAGGCTTAGAAATGACCTTCTCAATAGACCTGTATTGAGTTTA
AGACCACCGCAAGCAACATTCAGCTGTTCTGGAGCAGATTTTGATGCAGGAATGTTATCTATGCTTAACT
TAAATACTTTTGGGGATATGTTAAGCCAAGCGGGAACAAGTGTTGCTTGGGGAATAATGATAGGGCTTGT
TTATTCACTACCCGGTATAGGAGATGCATTCCAAAAACTGAACGAATGGGCAAGAATGTTTCAACAGCTT
ATATCAAACAGCTGTATGATTGGAACACAAATTGGTAAAAACTTGGGAAGTTCTATATGGGAAAGCGGTA
GAACTAATGCACAGGGCAAAGGTGTGGCTTCTGGTAGTGTATCCTCTTTTGAAGCTGCACAAAAGGAGTT
TATTGACCTAATAAAAACCACAGGGGAAATTAAAAAATTCTTTGGGACTATACCTTATGGTCCTTTGTAT
GAAGGTGGATGGACAGATACAGAAACAGCTGATTTAGTAGCTTCACTATTTGGTGTTTTAGAATGGAGAG
CGGTAGATACAGCTGGTAATGACTGCACAGATACATCTTGCTTGAAAAATGCCAAAATCAAGGTGGTTTA
CTATCCACCACTTACAAACAATCTGCAAGATATTATTAACGGAGCTACAATGCAAATATATCACTGCAAC
TGGGGATATGACACAAACATAGGAACTTTTAAATGCAATGGTGGTGTTGAAGTTTCTAATAAAGACATAC
CAGAAGGTCTAAGACAAAAAATAGTTAATAGAATAGATGGAATAGTTGATGACATTATTGATGGAACTTT
TATGGCAAATCCTGATGATGCTCAATGGATAAAATCTGTGCCTTTGCCAAACTTTCCAGAGGTTATAAAC
TATTTGGCAATACTGAAAAAACAAGGTTTTACTTCACAGTATAATTCTGCTCTTTATGGAGTTTCAGAGT
TAATATCATCAATGATGTTGAAAGTATTAATTGATAATGCCTATGCTTCTTTATCTTCAATCGGGAGATA
CTTTACAAATAAAGATATGCCTAAAGACTTGGCAGGTGCCCAGCAAAACATTACAAAAGTAAAAGCACAG
ATAGATGATTATATTCAAAAGAATATTCAGTCTAACTACATAACTATACAGGTGGCTTCCCAGACATATA
GGAGTATCAAATCAGCAGTAGAGAAAGGTTTTGTTGATAAATTTGGACAAACAGCATATCTGTTTATGAG
GTAA
 Primer design