SecReT4
Protein ID: 225685380
T4SS name [ID]Tra_F [803]
Gene symboltraE
Locus tagPERMA_A0045
StrainPersephonella marina EX-H1
Repliconplasmid unnamed [GenBank: NC_012439] [Browse all T4SS(s) in this replicon]
Location [Strand]35294..35821 [-]
Producttype IV conjugative transfer system protein TraE
Component typeTraE_F
UniProt IDC0QUX4
KEGG IDpmx:PERMA_A0045
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 9.8e-13, Aligned region: 15..169
Protein Sequence: 175 a.a.     [Download]
>gi|225685380|ref|YP_002729773.1| type IV conjugative transfer system protein TraE [Persephonella marina EX-H1]
MKYIERWSELYRKNAILLFVVFLQAVLIVFLLTAVLYLAVKRTAVIAIPPTGTQIATGSETHRLLWGRYY
IDLLMNFSKNDIDNRLNILFTFIQNPKARERLIREAEEIKKNDIVQVFIPYESTWKVQGGVVSVKGHIKR
WIGTTLVRDEDVLVKVKLRPSGSIIALEDWKYEKP
 
Nucleotide Sequence: 528 bp     [Download]
>gi|225685337|ref|NC_012439.1|:c35821-35294 Persephonella marina EX-H1 plasmid unnamed, complete sequence
ATGAAATATATAGAGAGATGGTCAGAGCTTTATCGTAAAAATGCTATATTACTTTTCGTAGTTTTTCTGC
AAGCGGTTCTTATAGTTTTTCTACTAACAGCAGTATTATATTTAGCGGTTAAAAGGACAGCTGTTATAGC
CATTCCACCAACAGGAACTCAAATAGCAACAGGTAGCGAAACCCACAGGCTTTTATGGGGAAGATATTAC
ATAGACCTTTTAATGAACTTCTCAAAGAATGATATTGATAACCGACTAAACATCCTCTTTACATTTATCC
AAAATCCAAAAGCAAGGGAAAGGCTAATAAGAGAAGCAGAAGAAATAAAGAAAAATGATATTGTTCAAGT
ATTTATCCCTTACGAAAGCACATGGAAAGTTCAAGGTGGTGTTGTTTCGGTTAAAGGGCACATCAAAAGA
TGGATAGGGACAACTCTTGTTAGAGATGAAGATGTGCTTGTGAAGGTGAAACTTAGACCATCGGGGTCAA
TTATAGCACTGGAGGACTGGAAATATGAGAAGCCTTAA
 Primer design