SecReT4
Protein ID: 225685384
T4SS name [ID]Tra_F [803]
Gene symbol-
Locus tagPERMA_A0002
StrainPersephonella marina EX-H1
Repliconplasmid unnamed [GenBank: NC_012439] [Browse all T4SS(s) in this replicon]
Location [Strand]972..2924 [+]
Producthypothetical protein
Component typeTraD_F
UniProt IDC0QUT1
KEGG IDpmx:PERMA_A0002
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 9.1e-15, Aligned region: 398..484
AAA_10 [PF12846], Evalue: 5.5e-13, Aligned region: 128..472
T4SS-DNA_transf [PF02534], Evalue: 4.3e-11, Aligned region: 129..270
T4SS-DNA_transf [PF02534], Evalue: 4.3e-11, Aligned region: 409..531
TrwB_AAD_bind [PF10412], Evalue: 3.9e-08, Aligned region: 399..487
Protein Sequence: 650 a.a.     [Download]
>gi|225685384|ref|YP_002729730.1| hypothetical protein PERMA_A0002 [Persephonella marina EX-H1]
MGIKEAVLLIPLLGYILFVRDSIRWAKRISEKDPNPKRAKYTNLFLITVSIFAIPIFMILVFLFSPTIGA
FVWSGAALIFSFYVAYGLYGFLKSRLPNFKSKYKIEPITPEFKIFREPEIKISASAINKHVHVLAPTGSG
KTKSIVGPVLQQAIDKGLGVMSIDPKGDNEVSLACIDLLQKQGRLKDYWYYDVMLPNYSRSYNPLYSGIK
YNNPAQLGVLIIATMPKSGGAATFYEKVQSEFTRAMVRLLSLVNHTGKMANFIDLYSILAYLPYSIEYLL
DTYQANAKFKDELAELWIKTIAQEAAENQNFRQFLRGLQQHLALYAFTFHPKLLNSYNPEIKISEGFRQS
KLMNFSLRSLDFPSGESLDIGKMILMDLQSYAAYKTRENIQNEFPDIVIVDEAPQVIPPEFQKIFEMARG
AGIGVMVLHQSTKQFDNIQKGMFENIFTNCHVKVCLGAADRETAEFYARLLGEELKMFKTYSRGGENVWK
KPIDAILPHWNELVSERYDYRVRPEDIINMPIGEGLLIVREKDLFGVRGKTYFFATKMEGKPWYYLPKIP
YNDDWKDENLGLNLLSKFQKEFGDRIPDEDRKAVRNKKKQIANNIEQRADKIREELGDEIGINMVDEGIA
SVQNVPDELTNILGATDGML
 
Nucleotide Sequence: 1953 bp     [Download]
>gi|225685337|ref|NC_012439.1|:972-2924 Persephonella marina EX-H1 plasmid unnamed, complete sequence
ATGGGGATAAAAGAAGCTGTCCTGTTAATACCACTTTTAGGTTATATTCTCTTTGTAAGAGATAGTATCA
GATGGGCTAAAAGAATATCCGAAAAAGACCCTAATCCTAAAAGGGCTAAATATACAAACTTGTTTCTGAT
AACAGTATCTATATTTGCTATTCCAATTTTTATGATTTTAGTTTTCCTTTTTTCTCCGACTATTGGTGCT
TTCGTATGGTCTGGAGCTGCACTGATTTTTTCTTTTTATGTAGCCTACGGACTTTATGGATTTTTAAAAT
CAAGACTTCCAAACTTTAAGTCTAAATACAAAATAGAACCAATTACTCCAGAGTTTAAGATATTTAGAGA
ACCTGAAATAAAAATATCGGCTTCGGCAATAAATAAGCATGTCCATGTTCTTGCACCTACAGGTTCAGGT
AAAACAAAATCCATTGTAGGTCCTGTTCTTCAACAGGCTATTGATAAAGGACTTGGAGTTATGAGTATTG
ACCCTAAAGGAGATAATGAAGTTTCTCTTGCCTGTATAGACCTGCTTCAAAAACAGGGCAGATTGAAAGA
CTACTGGTATTACGATGTTATGCTTCCTAACTATTCAAGGTCTTATAATCCCTTGTATAGTGGTATCAAA
TATAACAATCCAGCACAACTTGGAGTTTTAATTATCGCTACAATGCCAAAATCTGGAGGAGCTGCAACTT
TTTATGAAAAGGTTCAGTCTGAATTTACAAGGGCAATGGTAAGGCTTCTATCTCTTGTGAACCATACAGG
AAAGATGGCTAACTTTATTGACCTTTACTCTATACTTGCATATTTACCATATTCAATAGAATATCTACTT
GATACTTATCAGGCTAATGCAAAATTTAAAGATGAGCTTGCAGAACTATGGATAAAAACAATTGCACAGG
AAGCAGCTGAAAATCAAAACTTCAGGCAGTTTTTAAGGGGACTGCAACAGCATTTAGCTTTATATGCTTT
TACATTCCATCCTAAATTGCTGAACTCATACAACCCAGAAATAAAAATATCTGAAGGTTTTAGACAGTCT
AAACTTATGAACTTTTCTTTAAGGTCTTTGGATTTTCCATCTGGAGAGAGTTTGGATATAGGAAAAATGA
TATTAATGGACTTGCAAAGCTATGCAGCATATAAGACGAGAGAGAATATACAAAATGAATTTCCAGATAT
TGTTATAGTTGATGAAGCACCACAGGTAATACCACCTGAATTTCAAAAGATATTTGAAATGGCAAGAGGA
GCAGGTATTGGAGTTATGGTTCTGCATCAATCTACCAAACAGTTTGATAATATTCAAAAAGGAATGTTTG
AAAATATATTTACAAACTGCCATGTAAAGGTTTGCTTAGGAGCTGCAGATAGGGAAACAGCTGAATTTTA
TGCAAGGCTACTTGGTGAGGAACTAAAGATGTTTAAGACTTATTCAAGAGGTGGAGAAAATGTATGGAAA
AAACCGATAGATGCCATACTTCCACACTGGAATGAGCTTGTATCTGAAAGATACGATTACAGAGTAAGAC
CTGAAGATATTATCAATATGCCTATTGGGGAAGGTTTACTTATTGTTAGGGAAAAAGATTTGTTTGGTGT
TCGTGGTAAGACCTATTTCTTTGCAACAAAAATGGAAGGAAAACCTTGGTATTACCTGCCTAAAATACCT
TACAATGATGATTGGAAAGATGAAAATCTTGGCTTGAATTTGCTTTCAAAGTTCCAGAAAGAGTTTGGAG
ATAGAATACCTGATGAAGATAGAAAGGCAGTAAGGAATAAGAAAAAACAGATTGCGAATAATATTGAACA
AAGAGCTGATAAGATTAGAGAGGAACTTGGGGATGAGATAGGAATAAATATGGTTGATGAAGGTATAGCT
TCAGTGCAGAATGTTCCTGATGAACTAACTAATATATTGGGGGCTACAGATGGAATGCTTTAA
 Primer design