SecReT4
Protein ID: 225685386
T4SS name [ID]Tra_F [803]
Gene symboltraV
Locus tagPERMA_A0038
StrainPersephonella marina EX-H1
Repliconplasmid unnamed [GenBank: NC_012439] [Browse all T4SS(s) in this replicon]
Location [Strand]30946..31461 [-]
Producttype IV conjugative transfer system protein TraV
Component typeTraV_F
UniProt IDC0QUW7
KEGG IDpmx:PERMA_A0038
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 7.3e-19, Aligned region: 27..154
Protein Sequence: 171 a.a.     [Download]
>gi|225685386|ref|YP_002729766.1| type IV conjugative transfer system protein TraV [Persephonella marina EX-H1]
MKRHVLALIFVVPFLTGCSSILGIGHENFRCEGTDKGGVCAPVDKVYKDRHLLGNQKDTVIDREKEKEIS
EEKEEGVFYEGCYGEVKISKDGKPKCNLKPKAEIKVRVIKEKPFAQPIRIQPKIAKIWIQPYVDENGNLV
DGRYIYVIVKKGGWLLPDGTKIYDDEVKDDN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|225685337|ref|NC_012439.1|:c31461-30946 Persephonella marina EX-H1 plasmid unnamed, complete sequence
ATGAAAAGGCATGTGTTGGCATTAATCTTTGTAGTTCCATTCTTAACAGGTTGCAGTTCTATACTGGGTA
TAGGACATGAAAACTTCCGATGTGAAGGGACAGACAAAGGGGGAGTTTGTGCACCTGTTGACAAGGTTTA
TAAGGATAGACATCTGCTTGGAAATCAGAAGGATACAGTGATAGATAGGGAGAAGGAAAAAGAAATTTCA
GAGGAAAAAGAGGAAGGAGTATTTTATGAAGGTTGTTATGGGGAAGTAAAAATTTCCAAAGATGGAAAGC
CTAAATGCAATTTGAAACCAAAAGCAGAGATAAAGGTTAGGGTTATAAAGGAAAAACCATTTGCACAGCC
TATTAGAATACAGCCGAAAATAGCAAAAATCTGGATACAGCCGTATGTGGATGAAAACGGAAACTTGGTA
GATGGTAGATACATCTATGTAATAGTTAAAAAAGGCGGTTGGCTTTTACCTGATGGAACAAAAATTTATG
ATGATGAGGTAAAAGATGATAACTAA
 Primer design