SecReT4
Protein ID: 225685390
T4SS name [ID]Tra_F [803]
Gene symbol-
Locus tagPERMA_A0022
StrainPersephonella marina EX-H1
Repliconplasmid unnamed [GenBank: NC_012439] [Browse all T4SS(s) in this replicon]
Location [Strand]15327..16043 [-]
Producthypothetical protein
Component typeTrbC_F
UniProt IDC0QUV1
KEGG IDpmx:PERMA_A0022
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 6.9e-11, Aligned region: 122..230
Protein Sequence: 238 a.a.     [Download]
>gi|225685390|ref|YP_002729750.1| hypothetical protein PERMA_A0022 [Persephonella marina EX-H1]
MLFRISISLIFGICVSAFALTDEEQKYVEENKTNIQEVEKNFKELTEKKQKVDEEMLMVKPENLKEVGKF
KSLTENKADVSEYKKLGENVNLKLLENIYGKNWLDIRLKLEGKPEKKNLIFYLFSTSVPMQTVKNVFLAS
QKYENLEFYGVLRGISKKTWKYLNSLDEAMNNMTVKVNPLIFKAVDAEVVPAFVIAECPERPYGIIRSKS
CKFKAVLYGDVSLDFAVEKFKEEGLWKE
 
Nucleotide Sequence: 717 bp     [Download]
>gi|225685337|ref|NC_012439.1|:c16043-15327 Persephonella marina EX-H1 plasmid unnamed, complete sequence
TTGCTGTTTAGGATTTCAATTTCCTTAATCTTTGGAATATGTGTATCCGCTTTTGCTTTAACAGACGAGG
AACAGAAGTATGTAGAGGAAAACAAAACAAATATCCAAGAAGTAGAGAAAAACTTTAAGGAACTGACGGA
GAAGAAACAAAAGGTGGATGAGGAGATGTTAATGGTTAAACCAGAAAATTTAAAGGAGGTAGGAAAGTTT
AAAAGCCTCACAGAAAATAAGGCTGATGTTTCAGAATACAAAAAACTTGGAGAGAATGTAAACCTAAAGC
TTTTAGAAAACATCTATGGTAAGAACTGGCTTGATATTCGTTTAAAACTTGAAGGAAAACCAGAAAAGAA
AAACCTAATTTTCTATTTATTCTCAACATCCGTTCCTATGCAAACTGTGAAAAATGTATTTTTAGCTTCA
CAGAAGTATGAAAACTTAGAGTTTTATGGGGTATTAAGAGGAATAAGCAAAAAAACTTGGAAATATCTAA
ACTCTTTAGATGAAGCTATGAATAATATGACTGTAAAGGTAAATCCATTAATTTTCAAAGCTGTAGATGC
AGAAGTAGTTCCTGCTTTTGTGATAGCTGAATGCCCAGAAAGACCTTATGGGATTATCAGAAGTAAATCT
TGTAAATTCAAAGCAGTTTTGTATGGAGATGTTTCCCTTGATTTTGCAGTAGAAAAATTTAAAGAGGAAG
GATTATGGAAAGAATAA
 Primer design