SecReT4
Protein ID: 225685392
T4SS name [ID]Tra_F [803]
Gene symbol-
Locus tagPERMA_A0031
StrainPersephonella marina EX-H1
Repliconplasmid unnamed [GenBank: NC_012439] [Browse all T4SS(s) in this replicon]
Location [Strand]20265..23756 [-]
Producthypothetical protein
Component typeTraG_F
UniProt IDC0QUW0
KEGG IDpmx:PERMA_A0031
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 5.5e-48, Aligned region: 7..468
Protein Sequence: 1163 a.a.     [Download]
>gi|225685392|ref|YP_002729759.1| hypothetical protein PERMA_A0031 [Persephonella marina EX-H1]
MAIDLDLYTVGNIETLSQVYKYLVLILGDSFIGTVIKITAVWGLIFAILASAFKGRFSIWIYHFLMTYVL
FQIFFMPVVRLTIIDTKLDRTYVVDNVPFGVGFIASMASGFSYKLTNLIDNAFHTGTVVVWGPGTGSYVA
GVDYSRMGFAGMFDYLKMGLKIDPRLVQTKFNAVYEMQAYIEQCFFPYVSTLSATEIDNLRKSNNLLADL
RVDNSFLMSYNGTTWTCDDFYDNKLVPDWNDFVNTGATTPQLFGFADYMTVRMVDSINAMTNASMSFNQI
ITQSGIINMIKESYFTSGLADDMNNRLLAGYAVGRAEEQAKLMGKAMFLWAKKVIPFMQGFLEAFFVILF
PFLIILLFIPLVSFGGVQPAIGYLKVIVWVYLFIPILAIIDGMIKLQAINKTIAWLNSVGLQGITLGDYG
FLLEQADFYPAIAGFAAMSTPLWAWMLLKGFEAGVHGISALVGSMGSQFVGQEAGAANITRNMTRDSREL
MANMGAGQSPVEALSNAGTWMYKENTNLGGLYSSLGAYNAHSILESQLGIGGAVQTTTAQALYGLTHSGG
RGMAAWNASGGNVMNMLNTGAMTSPAQIIERDYGTLGLKYDAQGNLVAAEFNTGIKSDMMQANLQTTFSQ
SRNDVISTAWNAVWGNSQTYQKAYQSTSAITEQFLKDYTSGTGIEDRASFDNRAEVKEAFTDAKELRDTL
TEEYGLSKDKANQFVAEFTTGLSAAAAKNGGKLDINTVKDVFKSVLSKFKADGSVGAKGIENFEETEAWK
EATQYADNKSYQIVQDTALSYTTSHNAYFNRVKQEKGAELQDVSYQDLQQFHENWQKAEQITAQINRAFN
QTQTELGSLNTNNLIGFIRWMNGGHIDKQKETMMMDRILTAVANNDKPFLDNLSKAYTAYVMEMQGMTDV
SPGVSKFFTQKQAFLNMVQGQVDNAAVNIATHFNQHYEGINTLRNMAGVSPYQNLQAEAGDRFAYVGSNQ
ASIENGVYAGKGNIKPISKPQWTGEVEQYTKDPTNPIELGKNIVNYGKEHGAWGTAMAVGTGSVILGTAM
EYAPWAKQAFDTMKSGASKVWTTIRTAEPIAEMGTGRWAQFAAGGRLLTIPVGTTAGVAMAATTVPLAAV
GGWAIGTAINNKWGDDIYNNFTEPVLDWIGEKTGWWKPVGGNK
 
Nucleotide Sequence: 3492 bp     [Download]
>gi|225685337|ref|NC_012439.1|:c23756-20265 Persephonella marina EX-H1 plasmid unnamed, complete sequence
ATGGCTATTGATTTAGACCTTTATACAGTTGGGAACATAGAAACCTTATCACAGGTATATAAGTATCTGG
TTTTAATACTGGGTGATAGTTTTATAGGAACTGTTATAAAAATCACAGCTGTATGGGGGCTGATTTTTGC
CATTCTTGCTTCTGCTTTCAAGGGTCGGTTTTCCATCTGGATATATCATTTCTTGATGACCTATGTTCTT
TTCCAGATATTCTTTATGCCTGTTGTTCGGCTTACCATCATAGATACAAAGCTTGATAGAACTTATGTTG
TGGATAATGTGCCTTTTGGAGTGGGTTTTATTGCTTCAATGGCAAGTGGATTTTCTTATAAACTTACAAA
CCTAATAGATAATGCTTTTCATACTGGAACTGTTGTTGTCTGGGGACCGGGAACTGGTAGTTATGTGGCA
GGCGTTGATTATTCCAGAATGGGCTTTGCTGGAATGTTTGACTATTTAAAGATGGGGCTAAAAATAGACC
CACGGCTTGTTCAAACAAAATTTAATGCTGTTTATGAAATGCAAGCTTATATAGAACAGTGTTTCTTTCC
TTATGTGTCAACCTTAAGTGCAACGGAAATAGATAATCTTAGAAAAAGCAATAACCTGTTAGCAGATTTA
AGAGTAGATAATTCTTTCCTTATGAGTTATAACGGCACTACTTGGACTTGTGATGATTTTTATGACAATA
AACTCGTTCCTGATTGGAATGATTTTGTAAATACTGGAGCTACTACACCACAACTCTTTGGCTTTGCAGA
CTATATGACTGTTCGTATGGTTGATAGTATCAATGCAATGACTAATGCAAGCATGTCATTTAACCAGATA
ATTACCCAGTCAGGAATTATCAATATGATAAAGGAAAGCTATTTTACTTCTGGTCTTGCCGATGACATGA
ATAATAGACTACTTGCTGGATATGCTGTCGGTAGGGCTGAAGAACAGGCAAAGCTTATGGGTAAAGCAAT
GTTCTTATGGGCTAAAAAGGTTATTCCATTTATGCAAGGCTTCCTTGAGGCATTCTTTGTAATTCTGTTT
CCGTTTTTAATAATCTTATTGTTTATACCACTTGTTTCTTTCGGGGGTGTCCAGCCAGCTATTGGATACC
TTAAGGTGATAGTATGGGTTTATCTTTTTATTCCGATTTTAGCAATAATAGATGGAATGATAAAACTACA
AGCTATAAATAAAACAATAGCTTGGCTTAATTCTGTTGGACTTCAGGGTATTACACTTGGAGACTATGGG
TTCTTGTTGGAACAGGCAGATTTTTATCCTGCAATTGCTGGATTTGCCGCAATGTCAACTCCACTTTGGG
CTTGGATGCTATTAAAGGGTTTTGAGGCAGGAGTTCATGGAATTAGTGCATTAGTAGGTTCTATGGGAAG
TCAATTTGTAGGACAGGAAGCTGGAGCTGCAAACATAACAAGAAATATGACAAGAGACAGCAGAGAGCTT
ATGGCAAATATGGGTGCTGGTCAATCTCCAGTAGAGGCGTTATCCAATGCAGGAACTTGGATGTATAAAG
AAAATACAAATTTAGGCGGGTTATATAGCAGTTTAGGTGCTTATAATGCACATTCTATTTTAGAAAGTCA
ACTTGGCATTGGAGGGGCTGTTCAGACAACAACAGCACAAGCTTTATATGGACTTACACACTCAGGTGGT
AGAGGTATGGCTGCTTGGAATGCCTCTGGTGGAAATGTAATGAATATGCTAAATACTGGAGCTATGACTT
CACCAGCACAAATCATAGAAAGAGACTATGGAACTCTTGGTCTTAAATATGATGCACAAGGAAACTTGGT
AGCCGCTGAATTTAATACGGGAATAAAATCAGATATGATGCAAGCAAACCTGCAAACAACATTTTCTCAA
TCCAGAAACGATGTTATATCAACTGCTTGGAACGCAGTCTGGGGTAATAGCCAGACATATCAAAAAGCTT
ATCAATCTACATCTGCTATAACAGAGCAGTTTTTAAAAGACTACACATCTGGAACGGGTATAGAGGATAG
AGCTTCATTTGATAATAGGGCAGAAGTAAAAGAAGCCTTTACAGATGCAAAAGAGTTAAGAGATACACTA
ACGGAAGAATATGGACTATCAAAAGATAAAGCTAATCAGTTTGTTGCAGAATTTACGACAGGGTTAAGTG
CAGCAGCTGCTAAAAACGGCGGTAAGTTGGATATTAATACCGTTAAAGATGTATTTAAAAGTGTTCTATC
TAAATTTAAAGCAGATGGTTCTGTTGGTGCTAAAGGAATTGAAAATTTTGAGGAAACAGAGGCTTGGAAA
GAAGCTACTCAATATGCAGATAATAAGTCCTATCAAATTGTTCAAGATACAGCTTTATCATATACAACAA
GTCATAATGCATATTTCAACAGGGTAAAACAAGAAAAAGGAGCGGAACTTCAGGATGTTTCTTATCAAGA
CTTACAACAGTTCCATGAGAATTGGCAAAAAGCAGAACAGATTACAGCACAAATTAATAGGGCATTTAAT
CAAACACAAACGGAGCTTGGAAGTTTAAATACAAATAACCTAATAGGATTTATTAGATGGATGAATGGAG
GACATATAGATAAGCAGAAAGAAACTATGATGATGGATAGAATTCTTACAGCTGTGGCTAATAATGACAA
GCCATTTTTAGATAATTTGTCAAAAGCCTATACTGCTTATGTTATGGAAATGCAAGGGATGACAGATGTA
TCTCCAGGGGTATCAAAATTTTTCACTCAAAAGCAGGCTTTCCTAAATATGGTTCAGGGTCAGGTAGATA
ATGCCGCAGTTAACATAGCTACTCATTTTAATCAGCACTACGAAGGGATAAATACACTAAGAAATATGGC
AGGTGTTAGTCCATACCAGAACCTTCAAGCTGAAGCTGGAGACAGATTTGCTTATGTTGGTTCAAATCAA
GCAAGTATTGAAAATGGTGTTTATGCTGGAAAAGGGAATATAAAGCCTATCAGTAAGCCTCAATGGACTG
GAGAAGTGGAGCAATATACAAAAGACCCCACAAATCCGATAGAGCTTGGAAAAAACATAGTTAACTATGG
AAAGGAGCATGGGGCTTGGGGAACTGCAATGGCTGTGGGAACTGGAAGTGTTATTTTGGGAACTGCTATG
GAATATGCACCTTGGGCTAAACAAGCATTTGATACAATGAAAAGTGGAGCTTCAAAAGTATGGACAACTA
TTAGAACTGCTGAACCAATAGCAGAAATGGGAACGGGTAGATGGGCACAGTTTGCAGCTGGAGGCAGGTT
ATTAACTATTCCTGTTGGAACTACTGCTGGTGTAGCAATGGCGGCAACGACAGTTCCTCTTGCGGCAGTG
GGAGGCTGGGCAATAGGAACAGCTATAAACAATAAATGGGGAGATGACATTTATAACAACTTTACTGAAC
CAGTCTTGGACTGGATTGGTGAAAAAACAGGATGGTGGAAACCAGTAGGAGGGAACAAGTGA
 Primer design