SecReT4
Protein ID: 225685395
T4SS name [ID]Tra_F [803]
Gene symbol-
Locus tagPERMA_A0033
StrainPersephonella marina EX-H1
Repliconplasmid unnamed [GenBank: NC_012439] [Browse all T4SS(s) in this replicon]
Location [Strand]25166..26053 [-]
Producthypothetical protein
Component typeTraF_F
UniProt IDC0QUW2
KEGG IDpmx:PERMA_A0033
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 7e-28, Aligned region: 23..265
Protein Sequence: 295 a.a.     [Download]
>gi|225685395|ref|YP_002729761.1| hypothetical protein PERMA_A0033 [Persephonella marina EX-H1]
MRVLLLVCFLIGSALAFDKPDKGWFFYEDPEKPKKETVKKVEKKIEKPKEKKKEKPKKVEKPKPKPQPQQ
VVKKKKEDKFVFPVRPDAPQPVKEFLLNPNRETAEKFLAWQYQYFQHLQKIGFALREAYLAKGPQVYPIR
GYPESELASKLYFNDYRKHLIAKAIKRLKNRFGLIIFYSGKCKVCQQELPILLGLRQIYGITMRAVNVDG
NMIDLPIKQVYNPQLAKQYGITRVPTVVAVLEKKDGTVKQSVVGVGLMTADTILSMITQFLILEGEIKGS
ELNFYFSRNVVNEVK
 
Nucleotide Sequence: 888 bp     [Download]
>gi|225685337|ref|NC_012439.1|:c26053-25166 Persephonella marina EX-H1 plasmid unnamed, complete sequence
ATGAGGGTTTTACTGCTTGTTTGCTTTCTTATAGGTTCTGCACTTGCTTTTGACAAGCCAGATAAAGGCT
GGTTTTTCTATGAAGACCCAGAGAAACCGAAAAAGGAAACTGTTAAGAAAGTAGAGAAAAAGATTGAAAA
GCCAAAGGAAAAGAAAAAAGAAAAGCCGAAGAAAGTAGAAAAACCAAAACCCAAGCCGCAACCACAACAA
GTTGTAAAGAAGAAAAAAGAAGATAAATTTGTTTTCCCAGTTAGACCTGATGCACCACAGCCAGTAAAAG
AGTTCTTACTAAATCCAAATAGAGAAACAGCAGAAAAGTTTTTAGCTTGGCAGTATCAATATTTTCAACA
TCTACAAAAAATAGGTTTTGCATTAAGGGAAGCATATTTAGCTAAAGGACCACAGGTTTATCCTATTCGT
GGATACCCTGAAAGTGAGCTTGCCTCAAAACTTTACTTCAATGATTACAGGAAACACCTAATAGCTAAGG
CTATTAAAAGACTTAAGAACAGATTTGGTTTAATCATTTTTTATAGCGGAAAGTGTAAAGTTTGCCAGCA
GGAATTACCGATACTGCTTGGTTTAAGACAGATATATGGCATAACAATGAGAGCTGTCAATGTAGATGGG
AATATGATTGACCTGCCGATAAAGCAGGTTTACAATCCACAGCTTGCTAAACAATATGGGATAACCAGAG
TTCCTACTGTTGTGGCAGTATTGGAAAAGAAAGATGGAACAGTTAAACAATCTGTCGTAGGTGTGGGTCT
TATGACAGCTGATACTATACTTTCAATGATTACACAGTTTCTAATTCTTGAAGGAGAAATAAAGGGTTCA
GAATTAAACTTTTACTTTTCAAGAAATGTAGTTAACGAGGTGAAGTAA
 Primer design