SecReT4
Protein ID: 225685401
T4SS name [ID]Tra_F [803]
Gene symbol-
Locus tagPERMA_A0023
StrainPersephonella marina EX-H1
Repliconplasmid unnamed [GenBank: NC_012439] [Browse all T4SS(s) in this replicon]
Location [Strand]16016..16990 [-]
Productputative TraU
Component typeTraU_F
UniProt IDC0QUV2
KEGG IDpmx:PERMA_A0023
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3e-28, Aligned region: 16..318
Protein Sequence: 324 a.a.     [Download]
>gi|225685401|ref|YP_002729751.1| putative TraU [Persephonella marina EX-H1]
MTLISSFSISLAATPPCINPISTVDWSFFADTIEFKGTCVCSTSGAIKVGVKLQLAEPIAFIETPNKAWD
FICFGSTRDKFSVQKKDGTNLGKKGAKTNAHYIKYPVFGVLNITFDNLCTMHDLEFDIIPTGLSEINPLL
WDDELAMIAQPWKLLFANPIAQVLCLADCVSSSVVFPSNVDTFETVRNGLFYCAGCWGAIQPNTTTTRGK
DSVVESALTAVKLIDLLHESLQLKVYKEVSGLGWASNFSSGFPIPSDVACQPKFFPVIVKSQYWLNLSYP
VAWDAIPIGDFPPKWSWFKKYPSKEENIWTIWRIRNCCLGFQFP
 
Nucleotide Sequence: 975 bp     [Download]
>gi|225685337|ref|NC_012439.1|:c16990-16016 Persephonella marina EX-H1 plasmid unnamed, complete sequence
ATGACACTAATAAGTAGCTTTAGTATAAGTTTAGCCGCTACACCACCTTGTATTAATCCGATTTCAACGG
TTGACTGGTCTTTCTTTGCAGACACGATAGAGTTTAAAGGAACTTGTGTATGTTCTACATCTGGAGCTAT
AAAAGTTGGAGTAAAACTTCAGCTTGCAGAACCCATTGCCTTCATAGAGACACCAAACAAAGCATGGGAT
TTTATTTGTTTTGGTTCTACGAGAGATAAATTCTCTGTTCAGAAAAAGGATGGAACAAATTTAGGCAAGA
AAGGGGCTAAAACCAACGCACATTACATAAAATACCCTGTTTTTGGCGTTCTAAATATAACATTTGATAA
CCTCTGCACTATGCATGATTTAGAGTTTGATATTATTCCTACCGGTTTATCAGAGATAAACCCTTTACTA
TGGGATGATGAACTGGCTATGATTGCCCAACCTTGGAAATTACTATTTGCAAATCCAATAGCACAGGTTC
TATGTCTTGCTGATTGTGTTTCAAGTTCAGTAGTTTTTCCTTCAAATGTAGATACATTTGAAACGGTTAG
AAATGGACTTTTCTATTGTGCTGGTTGTTGGGGGGCAATACAACCCAACACCACCACAACCAGAGGTAAG
GATAGTGTTGTAGAAAGTGCCTTAACGGCTGTAAAGCTAATAGACCTGCTTCATGAAAGCCTGCAACTCA
AAGTCTATAAAGAAGTATCTGGTCTTGGATGGGCAAGTAATTTTTCAAGCGGTTTTCCTATCCCTTCTGA
TGTAGCATGTCAACCTAAATTCTTTCCAGTTATTGTTAAGAGCCAATACTGGCTTAATCTTTCCTACCCT
GTGGCTTGGGATGCAATCCCGATTGGAGACTTTCCACCCAAATGGAGCTGGTTCAAAAAATATCCATCAA
AAGAGGAAAACATCTGGACTATCTGGAGGATTAGAAATTGCTGTTTAGGATTTCAATTTCCTTAA
 Primer design